KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2805Help
Entry
SYNPCCN_2805      CDS       T01778                                 

Gene name
pfkA
Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCN_2805 (pfkA)
   00030 Pentose phosphate pathway
    SYNPCCN_2805 (pfkA)
   00051 Fructose and mannose metabolism
    SYNPCCN_2805 (pfkA)
   00052 Galactose metabolism
    SYNPCCN_2805 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SYNPCCN_2805 (pfkA)
Enzymes [BR:sys01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYNPCCN_2805 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SYNPCCN_2805 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3122862..3124016)
Genome map
AA seq 384 aa AA seqDB search
MGTKRIGILTSGGDCPGLNAVIRAVVKASALKGWEVYGIPYGTDGFVEVAHGKYQAEDLL
LTKHGYALPGMLKGLDVLQFLSGSVLGSLSKGHPEQPAIAEAILKGYAILDLEALIVIGG
DGSLDIIYDLAQKGNWHIIAIPKTIDNDVPFTDLAVGFSTAVDIVTQALYDLTFTAASHE
RIIIVQVMGRDAGHLTLHAGIAGGADIILIPEITPCLTSEIIRNCCYQLMNLRKSGRHFA
LIVISEGVHDQNNKKNKHIADYLAEEISETSQHLCDIKDPAFCDLISLDIRATTLGHLQR
SGTPLSFDRLLATVFGIRAVELIEQEIYDQVVIWRSGKVEHADLKPIISIIKECHQENRC
PFPVDRDGFMVKTAKSLGIYLGED
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggcacaaaacgtattggaattttgaccagtggtggtgattgtcctggcctcaatgcc
gtcatccgagcagtggttaaggcctcagctcttaaggggtgggaggtttatggtattccc
tacggcaccgatggttttgttgaagttgcccacggaaaataccaggcagaggatttactg
ttaactaaacatggctatgctctgcccgggatgctcaaaggcttagatgtattgcaattt
ctcagcggtagtgttttagggtccttaagtaagggacatccagagcaaccggcgatcgcc
gaagccattctcaagggttatgccatacttgacctggaagcactaattgttattggtggc
gatggtagtttagacattatttatgatttagcccaaaaaggtaattggcatattattgcc
attcccaaaaccattgacaatgatgtgccctttacggatctggcagtgggatttagcact
gcggtggatattgttacccaagccttatacgacctgacttttaccgccgctagccatgaa
cgcattatcattgtccaggtcatggggcgggatgcggggcatttgactctccatgcaggc
attgccggcggagctgatatcattttaattcccgaaattaccccttgtttgacttctgaa
attatccgcaattgttgttatcaactaatgaatttgcggaagtctggccgccattttgct
ttaatagttatttcagagggtgtccacgatcaaaataataagaaaaataaacatatcgcc
gactacttagcagaagaaatcagtgaaaccagtcaacacctttgcgacattaaagatccc
gctttttgcgatctaataagtctagacattcgagccacaaccctgggtcatttacaacgg
agcgggacccccctatcgttcgatcgcctcttggccacggtgtttggaattagggcagtg
gagttgatcgaacaggaaatttatgaccaggtggtgatctggcgcagtgggaaggtggaa
cacgctgaccttaaaccaattatcagcatcattaaagaatgtcaccaggaaaatcgctgt
cctttcccggtggatagggatggttttatggttaaaacggccaagtcattgggcatatac
ctaggagaagactaa

DBGET integrated database retrieval system