KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2850Help
Entry
SYNPCCN_2850      CDS       T01778                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SYNPCCN_2850 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYNPCCN_2850 (murE)
Enzymes [BR:sys01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SYNPCCN_2850 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3182550..3184067
Genome map
AA seq 505 aa AA seqDB search
MVKLGQLLASVPEVVAAAPWLAQESDRCPALGKIVTGLSTNSHACPPGTLFIGMPGTRVD
GGEFWSGALEAGAIAAVVSEKALQKFPPQNGECVIAVPDLVPVCAGLAAAFYQHPAQTLQ
LVGVTGTNGKTTTSHLIEYFLNQQQRSSALLGTLYTRWPGYQKTATHTTPFATDLQKQLA
EALQAGNQYAVMEVSSHALAQGRVLQCGFACAVFTNLTQDHLDFHGTMENYFAAKALLFK
ESYLQGRAVINQDDPYGQRLIDRLPLDQVYTYSVNDSTADFYTKDLDYQPTGVKGTFVTP
QGEFPFLSPLVGQFNLANVLAAIASGLHLGLDPAAMVKDLLDFPGVPGRMEQVQIRPDQD
ISVMVDYAHTPDSLENALKAARPFIPGRLICIFGCGGDRDRTKRPLMGNIAAQLADLAVV
TSDNPRTEDPEQILADVVQGISLDIEPWIIGDRATAIHKAIREAKPGDGVLIAGKGHEDY
QILGTEKIHFDDREQAREALILRYS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaagttagggcagttattggcatcggttccagaggtggtggccgccgccccttgg
ttggcccaggaatcggatcgttgccctgccctagggaaaatagtgactggtttatctacc
aattcccatgcctgtccccctggcactttattcattggcatgccgggcaccagggttgac
ggaggggagttttggtccggggccctagaagctggggcgatcgccgctgtggtcagtgag
aaggcgttgcaaaaatttccgccccaaaatggagaatgcgtcattgcggtgccggattta
gtgccggtgtgtgccggccttgcggcggccttttaccaacatcctgcccaaacgttgcaa
ctggtgggagtaacgggcaccaatggcaaaacgaccaccagccatttgattgaatatttc
ctcaatcaacagcaacggtccagtgctttgctgggaaccctctacacccgttggcctggt
taccaaaagaccgccacccacaccaccccctttgcgacggatttacagaaacaattggcc
gaagctctccaggcgggcaatcaatacgccgtgatggaagttagttcccatgccttggcc
cagggcagggttttgcaatgtggctttgcctgcgctgtgttcaccaacctcacccaggat
catttggacttccacggcaccatggaaaattattttgctgccaaggctttgttgtttaag
gagtcatatctccaaggtcgggcggtgatcaaccaagatgatccctacggccaaaggtta
atcgatcgcctaccgttggatcaggtttacacctacagcgtcaacgatagcactgcggac
ttttacaccaaggatttggactatcaacccaccggggttaagggcacgtttgttactccc
cagggggaatttcctttcctgtcccccttagtagggcaatttaacttggccaatgtgcta
gcggcgatcgccagtggcctgcaccttgggctagatccagccgccatggtgaaggattta
ctcgattttcctggggtaccggggcgcatggagcaggtacaaatccgcccggatcaagac
atttctgtgatggtggactatgcccacaccccggacagtttggaaaatgccctcaaggcc
gcccgcccctttatccccggccgcttgatttgtatatttggttgtggtggcgatcgggat
cgtaccaaacggcctttaatgggcaatattgcggctcagctggccgacctagcggtggtt
acctccgacaatccccgtaccgaagaccccgaacaaattttggccgacgtagtgcaaggc
atcagtctagacatcgaaccctggatcattggcgatcgggccaccgctatccataaggcg
atccgggaagcaaaaccgggggacggggtgttaattgccggcaaaggccacgaagactac
cagattcttggcacggaaaaaatccacttcgatgaccgggaacaggccagggaagcgttg
attttacgctacagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system