KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2850Help
Entry
SYNPCCN_2850      CDS       T01778                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sys00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sys00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3182550..3184067
Genome map
AA seq 505 aa AA seqDB search
MVKLGQLLASVPEVVAAAPWLAQESDRCPALGKIVTGLSTNSHACPPGTLFIGMPGTRVD
GGEFWSGALEAGAIAAVVSEKALQKFPPQNGECVIAVPDLVPVCAGLAAAFYQHPAQTLQ
LVGVTGTNGKTTTSHLIEYFLNQQQRSSALLGTLYTRWPGYQKTATHTTPFATDLQKQLA
EALQAGNQYAVMEVSSHALAQGRVLQCGFACAVFTNLTQDHLDFHGTMENYFAAKALLFK
ESYLQGRAVINQDDPYGQRLIDRLPLDQVYTYSVNDSTADFYTKDLDYQPTGVKGTFVTP
QGEFPFLSPLVGQFNLANVLAAIASGLHLGLDPAAMVKDLLDFPGVPGRMEQVQIRPDQD
ISVMVDYAHTPDSLENALKAARPFIPGRLICIFGCGGDRDRTKRPLMGNIAAQLADLAVV
TSDNPRTEDPEQILADVVQGISLDIEPWIIGDRATAIHKAIREAKPGDGVLIAGKGHEDY
QILGTEKIHFDDREQAREALILRYS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaagttagggcagttattggcatcggttccagaggtggtggccgccgccccttgg
ttggcccaggaatcggatcgttgccctgccctagggaaaatagtgactggtttatctacc
aattcccatgcctgtccccctggcactttattcattggcatgccgggcaccagggttgac
ggaggggagttttggtccggggccctagaagctggggcgatcgccgctgtggtcagtgag
aaggcgttgcaaaaatttccgccccaaaatggagaatgcgtcattgcggtgccggattta
gtgccggtgtgtgccggccttgcggcggccttttaccaacatcctgcccaaacgttgcaa
ctggtgggagtaacgggcaccaatggcaaaacgaccaccagccatttgattgaatatttc
ctcaatcaacagcaacggtccagtgctttgctgggaaccctctacacccgttggcctggt
taccaaaagaccgccacccacaccaccccctttgcgacggatttacagaaacaattggcc
gaagctctccaggcgggcaatcaatacgccgtgatggaagttagttcccatgccttggcc
cagggcagggttttgcaatgtggctttgcctgcgctgtgttcaccaacctcacccaggat
catttggacttccacggcaccatggaaaattattttgctgccaaggctttgttgtttaag
gagtcatatctccaaggtcgggcggtgatcaaccaagatgatccctacggccaaaggtta
atcgatcgcctaccgttggatcaggtttacacctacagcgtcaacgatagcactgcggac
ttttacaccaaggatttggactatcaacccaccggggttaagggcacgtttgttactccc
cagggggaatttcctttcctgtcccccttagtagggcaatttaacttggccaatgtgcta
gcggcgatcgccagtggcctgcaccttgggctagatccagccgccatggtgaaggattta
ctcgattttcctggggtaccggggcgcatggagcaggtacaaatccgcccggatcaagac
atttctgtgatggtggactatgcccacaccccggacagtttggaaaatgccctcaaggcc
gcccgcccctttatccccggccgcttgatttgtatatttggttgtggtggcgatcgggat
cgtaccaaacggcctttaatgggcaatattgcggctcagctggccgacctagcggtggtt
acctccgacaatccccgtaccgaagaccccgaacaaattttggccgacgtagtgcaaggc
atcagtctagacatcgaaccctggatcattggcgatcgggccaccgctatccataaggcg
atccgggaagcaaaaccgggggacggggtgttaattgccggcaaaggccacgaagactac
cagattcttggcacggaaaaaatccacttcgatgaccgggaacaggccagggaagcgttg
attttacgctacagctag

DBGET integrated database retrieval system