KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2927Help
Entry
SYNPCCN_2927      CDS       T01778                                 

Gene name
gap2
Definition
glyceraldehyde-3-phosphate dehydrogenase (NADP+)(phosphorylating)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sys00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNPCCN_2927 (gap2)
   01230 Biosynthesis of amino acids
    SYNPCCN_2927 (gap2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCCN_2927 (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNPCCN_2927 (gap2)
Enzymes [BR:sys01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     SYNPCCN_2927 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3275938..3276951)
Genome map
AA seq 337 aa AA seqDB search
MTRVAINGFGRIGRNFLRCWLGRTDSQLEVVGINDTSDPRTNAHLLRYDSMLGKLDADIS
ADENSITVNGKTIKCVSDRNPLNLPWAEWNVDLVIEATGVFVTHEGATKHVQAGAKKVLI
TAPGKGPNIGTYVVGVNAHEYKHEEYEVISNASCTTNCLAPIAKVINDNFGIIKGTMTTT
HSYTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVALVIPELQGKLNGIALRVPTPN
VSVVDLVVQVEKNTIAEQVNGVLKEAANTSLKGVLEYTDLELVSSDFRGTDCSSTVDGSL
TMVMGGDMVKVIAWYDNEWGYSQRVVDLAEIVAKNWK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgactagagtagcaattaacggatttggacggatcggacgcaactttctccgttgctgg
ctggggcgcaccgatagccagttagaagtagtcggtatcaacgacacctctgatcccaga
accaatgctcaccttttgcgctacgactccatgttgggtaagttggatgcggacatcagt
gccgacgaaaactccattaccgtcaatggcaagactattaaatgtgtttccgaccggaat
cccctcaatttgccctgggcagaatggaatgtagatctagtcatcgaagccaccggtgtt
tttgttacccatgaaggggccaccaagcacgttcaagccggagccaaaaaagttttaatc
actgctcctggcaaggggcccaacatcggcacctatgtggtgggggtcaatgcccacgaa
tataagcacgaagaatacgaagtaattagtaacgctagttgtactaccaactgcctcgcc
ccgatcgccaaagtaatcaacgacaattttggcatcatcaaaggcaccatgaccaccacc
cacagctacaccggagaccaacggatcctcgatgctagccaccgggatctacgccgggcc
cgggctgctgccgttaacatcgtgcccacctccaccggagctgccaaagcggtggccctg
gtaattcctgaactgcaaggcaaattgaacggtattgccctgcgggtgcccacccccaac
gtttccgtggtggatttggtagtacaagtagagaaaaacaccatcgctgaacaggttaac
ggagtgctcaaagaagcagccaacaccagccttaaaggagtgttggaatacaccgatttg
gaattggtttccagcgacttccggggcacggattgctcttccactgtggatggtagtctg
accatggtaatgggcggtgacatggttaaagtcattgcttggtacgacaacgaatggggc
tattcccaacgggtggtggacttggctgaaattgtggctaaaaactggaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system