KEGG   Synechocystis sp. PCC 6803 PCC-N: SYNPCCN_2933Help
Entry
SYNPCCN_2933      CDS       T01778                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
sys  Synechocystis sp. PCC 6803 PCC-N
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sys00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYNPCCN_2933 (recR)
DNA repair and recombination proteins [BR:sys03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SYNPCCN_2933 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3281343..3281981
Genome map
AA seq 212 aa AA seqDB search
MAPSVKFPLQKRGLGTIYTPPLARLIEQLQRLPSVGPKTAQRLALHLLKRPDAEVENLAQ
ALLDAKKRVGQCQVCFHLSAEPVCDICRHPQRDNSVICVVSDPRDVIALEKTREFRGKYH
VLGGVISPMDGIGPEQLTIQPLLHRVSQPEIKEVILAISPSVEGETTTLYLGKLLQPFTK
VTRIAFGLPMGGDLEYADEVTLARALEGRREL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttggccccatcagtaaaatttcccctacaaaagagaggtcttggcactatttatactcct
cccctagcccgtctcattgaacaattgcaacggctccccagtgtggggccaaaaactgcc
caacgtcttgccctgcatctgcttaaacgtcctgatgcggaggtggagaatttggcccaa
gccctcctcgacgcaaaaaaacgggtggggcaatgccaagtatgcttccatttatccgct
gagcctgtctgtgatatttgccgccatccccaacgggataacagtgttatctgtgtggtc
agtgaccccagggatgtgattgcgctggaaaaaactagggaattccggggtaagtaccat
gtgttgggcggggtaatttcccccatggacggcatcggcccggagcaattgaccattcaa
cccctattacatcgggttagtcagccagaaatcaaagaagtaattttggctattagtcct
agtgtggagggggaaaccaccacgttatatttgggcaaactcctgcaaccttttaccaag
gttacccgcattgcctttggtttgcccatgggaggggatttggaatatgccgatgaagtt
accctggctagggccttggagggacggcgagaattgtaa

DBGET integrated database retrieval system