KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_0269Help
Entry
SYNGTI_0269       CDS       T01777                                 

Gene name
pfkA
Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNGTI_0269 (pfkA)
   01230 Biosynthesis of amino acids
    SYNGTI_0269 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTI_0269 (pfkA)
   00030 Pentose phosphate pathway
    SYNGTI_0269 (pfkA)
   00051 Fructose and mannose metabolism
    SYNGTI_0269 (pfkA)
   00052 Galactose metabolism
    SYNGTI_0269 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SYNGTI_0269 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SYNGTI_0269 (pfkA)
Enzymes [BR:syt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYNGTI_0269 (pfkA)
Protein phosphatases and associated proteins [BR:syt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SYNGTI_0269 (pfkA)
Messenger RNA biogenesis [BR:syt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SYNGTI_0269 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(293878..294963)
Genome map
AA seq 361 aa AA seqDB search
MGEIKRIGILTSGGDCAGLNAVIRSVVHHAIGTYGWEVIGIQEATQGLMENPSKAIALHR
DNIDHLLMMGGTFLGTTNKGNPFAFPMADGTVRDRTEDIIAGYRQLGLDALIGIGGDGSL
AILRRIAQQGGINLVGIPKTIDNDVGATEISIGFDTATNIATEALDRLHFTAASHNRVMV
LEVMGRDAGHIALAAGIGGGADIILIPEIPYRIQSVCNKIRQRQAEGKNFCLVMVSEAVR
TELGDQVKQIQQFGEDRYGGIGKYIAEQIAQRTGAETRVTVLGHIQRGGIPSPFDRLLGS
VFGVAAVDLIAEGKFDHMVAWRNRQTISVPIEEAIQTYQTVQLDGTLVKTARGLGICLGN
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaattaaacgcattggtattttaaccagtggaggagactgtgccggactaaac
gccgtaattcgctccgtggtacaccatgccattggcacctacggttgggaagtaattggc
attcaagaagccacccagggactaatggaaaatccctccaaggcgatcgccctgcaccgg
gataacattgaccatttgttaatgatgggaggtacctttttaggcaccaccaataagggt
aatccgttcgcttttcccatggccgacggcactgtgcgggaccgcaccgaagatattatt
gccggttatcgtcagttggggcttgacgctctcattggcattggcggagacggtagttta
gccattttgcgccgcatagcccaacaggggggcatcaacttagtgggcattcccaaaacc
attgacaatgatgtgggggcaacggaaatttccattggtttcgacaccgccaccaacatt
gccaccgaagccttggatcgtttgcatttcaccgccgctagccataaccgggtcatggtg
ctagaagtgatgggtagggatgcgggccacattgccctggccgccggcattgggggaggg
gcggacattattctcattcctgaaattccctaccgcatccaaagtgtgtgcaataaaatt
cgtcaacggcaggccgaggggaaaaacttttgcctggttatggtgtcggaagcggtgcgg
acagaattgggcgatcaggtcaagcaaatccaacagtttggcgaagaccgctacggcggc
attggtaaatacattgcggaacaaattgcccaacgcactggagcagaaaccagagtcact
gtgctgggccacatccaacgggggggcattccttcacctttcgatcgcctgttggggagt
gtgtttggggtcgcggcggtggacttgattgcggaaggcaaattcgaccacatggtggcc
tggcgcaatcgtcaaaccattagtgtgcccattgaggaagccatccaaacctatcaaacg
gtgcagttggacggcaccttggtgaaaactgcgcggggattgggcatttgccttggtaac
gattaa

DBGET integrated database retrieval system