KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_0387Help
Entry
SYNGTI_0387       CDS       T01777                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:syt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420604..421833
Genome map
AA seq 409 aa AA seqDB search
MLRLITQSGDIVQELRRLHHRPVPSPWPVMAQVVAAMEHWAAMDQDAPPRVSGAELDAAY
QRISQEKLSVIRQACAALEQVYRPQLPKTQVSFPEDGTVRGQRFYPVRRAGFYLEAKRGD
ALGNLLRQGMLAKTVGVAERVLVTETISSTILVAAQEMGIEEIYLAAGVPAIAMLTWGAK
NIAPVESITGAGCPRVMAAKQLVSGVVTIDQTLARTNLMVLADGEANGQWLALDLLAHAE
QYPNASAVLLTDRLELGEEVIQSVNRYCREQEHSVHTEKALAHYGLVAIVEDLEACGSWI
NEFCPHILLLAMEDPWTMVEKVQRAREIYIGHRSPSILGHYLSGANRLQTQDGAMATASE
LAFHCFLRSSQLLDYGNNPPPPWLKDLVNWQGLTAIEERLGQLGRLKES
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtctcatcacccagtccggtgacattgttcaggagttgcgacgtttacatcat
cgtcccgttccttccccctggccggtcatggcccaggtggtggcggcgatggagcattgg
gctgccatggaccaggatgctccccccagagttagtggagcggagttggatgcggcttat
caacgcattagccaggaaaaattgtcggtgattcgccaggcttgcgctgccctggagcag
gtttaccgcccgcaactgcccaagacccaagtaagctttccggaagatggcacagtgcgg
ggacaaaggttttatccggtcagaagagctggtttttatctagaagcaaaaaggggcgat
gccctgggcaatttactccgccaggggatgttggccaagactgtgggggtggcggaacgg
gttttggtgacggaaaccattagttcgactattttggtggcggcccaggaaatgggcatt
gaagaaatttatctggccgctggggtgccggcgatcgccatgctgacctggggagcaaaa
aatattgccccggtggagtccattacaggggcaggctgcccaagggtgatggcggctaaa
caattggtgagtggtgtggtaaccattgaccaaaccctggctaggacaaatttaatggtg
ctagcggacggtgaagctaacggacaatggctagccctggatttgttagcccatgccgaa
caatatcccaatgccagcgcagtgctactgaccgatcgcctggagttgggggaagaggtg
attcaatcagtcaatcgctattgtcgggagcaggaacattctgtacatacggaaaaggct
ttggcccattacggcctagtggcgatcgtcgaagacctagaggcctgtggaagttggatc
aatgagttttgcccccatattttactgttagccatggaagacccctggaccatggtggag
aaagttcagcgagccagggaaatttacatcggccaccgcagtccgagcattttgggtcat
tacctcagtggggccaaccgtctgcaaacccaggatggggccatggccaccgctagtgaa
ttggcattccattgttttctgcgctccagtcaattactcgactacggcaataatccaccg
cccccttggttaaaggatttggtcaattggcaaggcctgacggcgatcgaggaacgcttg
gggcaattgggtcgactcaaggaaagttag

DBGET integrated database retrieval system