KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_0464Help
Entry
SYNGTI_0464       CDS       T01777                                 

Gene name
chlH
Definition
Mg-chelatase subunit
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNGTI_0464 (chlH)
Enzymes [BR:syt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SYNGTI_0464 (chlH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508617..512612
Genome map
AA seq 1331 aa AA seqDB search
MFTNVKSTIRRVDPEALNGRQLLKVVYVVLESQYQSALSAAVRNINRTNSSLAIQLTGYL
IEELRDPENYANFKHDVSEANLFIASLIFIEDLADKVVEAVTPYRDNLDAAIVFPSMPQV
MRLNKMGSFSMAQLGQSKSAIAQFMKKRKENSSGAGFQDAMLKLLRTLPTVLKYLPVEKA
QDARNFMLSFQYWLGGSQENLENFLLMLTDKYVYPDLGLDKLVNYQEPVVYPDMGIWHPL
SMQMFENVKDYLEWYNQRPDISEDLKDPLAPCIGLIMQRTHLVTGDDAHYVGMVQELEAM
GARVICVFSGGLDFSKPVNEYFWDKSVNGVEPLPIVDAVVSLTGFALVGGPARQDHPRAI
ESLKKLNRPYMCALPLVFQTTEEWEASDLGLHPIQVALQIAIPELDGAIEPIILSGRDGS
TGRAIALQDRLEAIAQRAMKWANLRKKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSI
YEVMKGLQGNGYDVQDLPGSAKELMEAVIHDAQAQYNSPELNIAHRMSVEQYERLTPYSV
RLEENWGKPPGHLNSDGQNLLIYGKEFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFA
AYYTYLNHIWKADAVLHFGTHGSLEFMPGKQMGMSGECYPDNLIGTIPNLYYYAANNPSE
ATIAKRRGYASTISYLTPPAENAGLYKGLQELNELIGSYQTLKDSGRGIQIVNTIMDQAR
ICNLDQDVNLPDINAEEMDQGQRDTIVGSVYRKLMEIESRLLPCGLHVIGQPPSAEEAIA
TLVNIASLDREDEGIWALPTLIAESIGRNMEEIYRNSDKGILADVELLQDITLATRAAVA
ALVQEQINADGRVSFVSKLNFFKIGKKAPWVKSLCDSGYPNVNEEKLKPLFEYLEFCLEQ
VCADNEFGGLLQALEGEYVLPGPGGDPIRNPNVLPTGKNIHALDPQSIPTLAAVQSAKVV
VDRLLERQRAENGGNYPETIASVLWGTDNIKTYGESLAQIMWMVGAKPVPDALGRVNKIE
LVPLEELGRPRIDVVVNCSGVFRDLFINQMNLLDQAVKLAAEADEPLEMNFVRKHALEQA
EEMGIGVREAATRIFSNASGSYSSNVNLAVENSSWEDESELQEMYLKRKSFAFNSDNPGM
MDQNRDMFERALKTADATFQNLDSSEISLTDVSHYFDSDPTKLISTLRDDGKAPAAYIAD
TTTANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATAGAV
DNWVYEDANSTFIKDEEMCKRLMDLNPNSFRRMVSTLLEVNGRGYWETSDENLERLQELY
QEVEDRIEGVE
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atgtttactaacgtcaagtccaccatccgccgtgttgatcccgaagcgttgaatggacgc
cagctactcaaggtggtttatgtggtcttggaatcccagtatcagagcgctttgtcggcg
gccgttagaaacattaaccgtaccaactccagcctggccattcagttaacgggctatttg
atcgaggagttgcgggacccggaaaattacgccaactttaaacatgacgtcagcgaagct
aatctcttcattgcttccctgatttttattgaagatctggccgataaggtggtggaagcg
gtaactccctatcgggacaatttggatgcggcgatcgtgttcccctccatgccccaggtg
atgcgcctgaacaaaatgggttccttttccatggcgcaattgggccagtccaaaagtgcg
atcgcccagttcatgaaaaagcgcaaggaaaacagcagtggtgctggcttccaggatgcg
atgttgaaactgttgcggaccctgcccacggtgttgaaatatttgccggtggaaaaggcc
caggatgcccgtaattttatgctcagcttccagtattggttgggaggctcccaggagaac
ttggaaaacttcctgctgatgctgaccgacaagtatgtttatcctgatttgggcttggat
aaactggtcaactaccaggagccagtggtctatcccgatatgggcatttggcatcccctg
tccatgcagatgtttgaaaacgtgaaggattacctggagtggtataaccaacgtcccgac
atcagcgaagatctcaaagatcctttagccccctgcattggtctgattatgcaacgcacc
cacctcgtcaccggggatgatgcccattacgttggcatggtgcaggaattggaagccatg
ggggcccgagtgatctgcgtgttctccggcggtttagatttctccaagcctgtcaacgaa
tatttctgggataaatccgttaacggtgtggaacccctgcccattgtggatgcggtggtt
tcgttaactggttttgctctggtgggtggccccgctcgtcaagatcatccccgtgccatt
gaatccctgaaaaagctcaaccgtccctatatgtgcgccctgcccctggtgttccaaacc
acagaggagtgggaagccagcgatttaggtttacaccccatccaagtggcgttacaaatt
gccattcctgaactggacggggcgatcgaaccgattattctttccggtcgggatggttcc
accggtcgggccattgctctccaagaccgcctagaggcgatcgcccagcgggccatgaag
tgggctaatttacgcaaaaaacctaagctggataaaaaagttgccattaccgtattcagt
ttcccccccgataaaggcaatgtgggcacagcggcctatctggacgtgtttggctccatc
tatgaagtgatgaaaggcctccagggcaacggctacgatgtgcaagatttacccggttcc
gccaaggaattaatggaagcggtcatccacgatgcccaagcccaatacaacagcccagaa
ttaaacatcgcccatcgcatgtcggtggagcagtatgaacgcctgaccccctactcggtg
cggttggaggaaaattggggcaaaccccccggacatctgaacagcgacgggcaaaattta
ctgatctacggtaaggaattcggtaacgtcttcatcggtgtacaacccacctttggttac
gaaggggaccccatgcgcttgctattctcccgttccgccagtccccatcacggttttgcc
gcttactacacctatttgaaccacatttggaaagccgatgcggtattacatttcggcacc
cacggttctttggaatttatgcccggtaaacagatgggcatgtccggggaatgctatccc
gataatttgattggcaccattcccaacttgtactactacgccgccaacaatccttctgaa
gctaccatcgccaaacggcggggttatgcgtccaccatttcctacttgacccctcccgca
gaaaatgccggtttatacaaaggtttgcaggagttaaacgagctaattggctcctaccaa
accctgaaggattccggccggggcatccagattgttaataccatcatggaccaggcccgc
atctgtaaccttgaccaagatgtcaatttgcccgacatcaacgccgaggaaatggatcaa
ggtcagcgggataccattgtcggttccgtttaccgcaagctgatggaaattgagtctagg
ctcctgccctgtggtctccatgtcattggccagcccccaagcgccgaagaggcgatcgcc
accctggtaaacattgccagtttggaccgggaagatgaaggcatttgggctttgcctacc
ctgattgcggaaagcatcgggcgcaatatggaggaaatttaccgcaacagtgacaagggg
attttggccgacgtggaattgttgcaagacattaccctagctaccagggctgctgtggcc
gctctggtacaggaacaaattaatgccgacggtcgagtttcctttgtttccaagctgaac
ttcttcaaaattggcaaaaaagctccctgggtcaaatccctctgcgattccggctacccc
aacgtcaatgaagaaaaactcaaacccctgtttgaatacctggaattctgtttggaacag
gtttgtgccgacaacgaatttggtggcctactccaagccctggaaggggaatacgtcctg
cccggccctggtggcgaccccatccgtaaccccaatgtgttgcccacaggaaaaaatatc
cacgccctcgatccccaatccatccccaccctggccgctgtccaatccgccaaagtagtg
gtcgatcgcctgttggaacggcaacgcgccgaaaatggtggtaattatcccgaaaccatt
gcttctgtgctctggggtacggataacatcaaaacctacggcgaatccctggcccaaatt
atgtggatggtgggagccaaacccgtccccgatgccctcggtcgggtaaataaaatcgaa
ctggtgcccctggaagaactgggtcgcccccgcattgacgtggtggtgaattgttccggg
gtattccgggatctgtttattaaccaaatgaacctgttggatcaagcggtgaaactagcc
gccgaagccgatgaacccctggaaatgaacttcgttcgtaagcacgccctggaacaggca
gaagagatgggcattggcgtaagggaagcggccacccggattttctccaacgcctccggt
tcctattcttccaacgtcaacttagcggtagaaaacagcagttgggaagatgagtcggaa
ttgcaggaaatgtacctcaaacgcaagtccttcgctttcaactccgataaccccggcatg
atggaccaaaatcgggatatgttcgagcgggctttgaaaaccgccgatgccacattccag
aacttggattcctcggaaattagcctcaccgacgtatcccactacttcgactccgacccc
accaagttaatttccaccctgcgggatgacggcaaagcccccgccgcttacattgccgac
accaccaccgccaacgctcaggtacgtaccctatcggaaacggtgcgccttgatgcccgc
acgaaattgctcaatcccaaatggtacgaagggatgctttcccatggctacgaaggggtg
cgggaactatccaaacggttagtcaataccatgggctggagtgccactgccggcgcagtg
gataactgggtttatgaggatgccaacagcaccttcatcaaagatgaggaaatgtgcaaa
cggttaatggacttaaaccccaactctttccgccgcatggtcagcactttgttggaagtc
aatggccgcggctattgggagacttctgatgaaaacttggaacggctacaggaactttat
caagaagtggaagaccgcattgaaggggttgaataa

DBGET integrated database retrieval system