KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_0700Help
Entry
SYNGTI_0700       CDS       T01777                                 

Gene name
folP
Definition
dihydropteroate pyrophosphorylase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNGTI_0700 (folP)
Enzymes [BR:syt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SYNGTI_0700 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
771753..772622
Genome map
AA seq 289 aa AA seqDB search
MDQLDQLSDYFPPPLPVGQTLFDWGKRTYVMGILNTTPDSFSDGGEFNSLPTAIHQAKTM
VQGGAHIIDIGGQSTRPGAETVSLKEELERTIPIIQALRQELDIPISIDTTRAEVARQAL
QAGADMVNDISGATFEPEILAVAAQHKAPIILMHIRGNPQTMQNLTDYGDLIGEMRQFFS
AQVDLARHYGVLPEQIILDPGIGFAKTAEQNITLLRQLPELKRLGFPLLVGPSRKSFIGK
ILDQPDPKERVWGTGATCCRAIAGGADIVRVHDVEAMAQICKVADALWR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaccagttggatcaattgagtgattattttccccctcccctcccggtgggccaaacc
ctttttgattggggcaaacgcacctatgtgatgggaattttgaatactacgccggacagt
tttagtgatgggggcgaatttaactctctaccaacggccatccaccaggctaaaaccatg
gtgcaggggggagcacacattattgacattggcggccagtccacccgaccgggggcagaa
actgttagcttgaaggaagaattagagcgcactattccgattatccaagctctccggcaa
gaattagacattcccatttccatcgataccaccagggcggaagtggcacgacaagctctc
caagccggagcggatatggtcaacgatatttccggagctacctttgaaccagaaattttg
gcggtcgccgcccagcacaaggctccgattattttgatgcacatacggggtaacccccaa
actatgcaaaatttgacggattatggggatttaatcggggaaatgaggcagtttttcagc
gcccaagtagatctagcccgccattacggcgtattgcccgaacagattatccttgaccca
ggcattggctttgctaaaaccgctgagcaaaatattaccctactgcgccagttaccggag
ctaaaaagacttggttttcccctattggtggggccatcccggaaaagtttcattggcaaa
attcttgaccaacctgatccgaaggaaagagtttggggtactggggcgacctgctgtcgg
gcgatcgccgggggagcagatatagtcagagtccatgatgtggaagccatggcccagata
tgtaaggttgcagatgccctatggcgatga

DBGET integrated database retrieval system