KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_0723Help
Entry
SYNGTI_0723       CDS       T01777                                 

Gene name
speB
Definition
agmatine ureohydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:syt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(800136..801308)
Genome map
AA seq 390 aa AA seqDB search
MSDATPFRPPSEAEEALIKETRLPLTGWQQEVDQGLTYGLEAAASIKDRSIPTFSRGELP
HYAGINTFMKAPYLEDVREVGKYDVAIVGVPHDSGTTYRPGTRFGPQGIRRISALYTPYN
FEMGVDLREQISLCDVGDIFTIPANNEKSFDQISKGIAHIFSSGAFPIILGGDHSIGFPT
VRGICRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNMANAPAKNLVQLGIGGW
QVPRQGVKVCRERATNILTVTDITEMSLDAAADFAIARATDGTDCVWISFDIDCIDAGFV
PGTGWPEPGGLLPREALYLLKRIIRETNVCGMEVVEVSPPYDISDMTSLMATRVICDTMA
HLVVSGQLPRTEKPAYIHAEANMAVDEPWQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgccaccccgtttcgtcccccttctgaagctgaagaagccttaatcaaagaa
actcggctacccctgaccggttggcagcaggaggttgaccaagggctaacctatggttta
gaagccgccgccagcattaaagaccgctccatccccaccttttcccggggagaattgccc
cactatgcgggcattaacaccttcatgaaggctccatatctggaagatgtgcgggaagtc
gggaaatatgatgtggcgatcgtcggagtgccccatgattctggcaccacctatcgacca
ggtacccgttttggcccccaggggattcgtcgtatttctgctttgtacactccctacaac
tttgaaatgggggtggatttacgggagcaaattagtctctgtgacgtgggggatattttc
accattcccgccaacaatgagaaatcctttgaccaaatttccaaaggtattgcccacatt
ttcagttccggagcgtttccgataattctggggggtgatcattccattggttttcctacg
gtgcggggcatctgtcgtcatttgggggataaaaaagtcggcattatccatttcgatcgc
catgtggacacccaggaaacggacttagacgaacggatgcacacttgtccctggttccac
gccaccaacatggccaacgctccagctaaaaacctagtgcaattaggcattggtggttgg
caagtaccccgccagggggtcaaagtttgtcgggaacgggccaccaacattttgaccgtc
actgatattaccgaaatgagtttggatgcggcggcggactttgccattgcccgggccacc
gatggcaccgattgcgtttggattagttttgacattgactgcattgatgcaggttttgtc
cccggcaccggttggccagaacccggtggtttactaccccgagaagctctgtatttactt
aaacgcattattcgggaaactaacgtttgcggcatggaagtggtggaagtttcccctccc
tacgacatcagcgacatgacttcgttgatggccaccagggtaatttgcgacaccatggcc
catttagtggtttctggccaattaccccgcacggaaaaaccggcctatatccatgctgaa
gcgaacatggcagtggatgagccctggcaatag

DBGET integrated database retrieval system