KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_1020Help
Entry
SYNGTI_1020       CDS       T01777                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYNGTI_1020 (ruvA)
Enzymes [BR:syt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SYNGTI_1020 (ruvA)
DNA repair and recombination proteins [BR:syt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SYNGTI_1020 (ruvA)
    RecFOR pathway proteins
     SYNGTI_1020 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1132366..1133001)
Genome map
AA seq 211 aa AA seqDB search
MIQFLQGQVVTVTKNIQNRWFLILSVNGVGYELQVPHSLAQQWTPPPPEPQQVFTHLLVR
QDQIALFGFGRLAERDLFGQLMGVTGIGAQLAIALIETLGLEGLVQAVVTGNVKQLCQTP
GVGKKGAERLALELKTKLSQWHKLQMGTGETDSTLPTTALLEDLEMTLLALGYTQTEIQQ
AIAMVSQVPDVAQSEDPEVWIRQAIGWLSDH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttcttcagggccaggttgttacagtcacaaaaaatattcagaaccgttgg
tttttgattttgtccgttaatggggtgggttatgagttgcaggtgccccattccttagcc
caacaatggactccgccccccccggaaccccaacaggtttttacccacctcttggtacgc
caagaccagatcgctctttttggttttggccgcctggcagaaagggatttatttggtcaa
ttaatgggagtaaccggcattggggcccagttggcgatcgccctaattgaaacgttgggc
ttggaaggcttagtgcaagcggtggtaacgggcaatgtcaaacaattgtgccaaacgccg
ggggtcgggaaaaagggagcggaaaggttagccctagaactaaaaactaaattatcccaa
tggcacaaactacaaatggggaccggggaaactgactctactctgcccaccactgccctc
ctggaagacctggaaatgaccttgttagcattgggttacacccaaacggaaatccagcag
gcgatcgccatggtcagtcaagttccagacgtggcccagagtgaagatccagaagtgtgg
atccgccaggcgatcggttggttaagtgatcactga

DBGET integrated database retrieval system