KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_1769Help
Entry
SYNGTI_1769       CDS       T01777                                 

Gene name
slr1171
Definition
(GenBank) glutathione peroxidase
  KO
K20207  
hydroperoxy fatty acid reductase [EC:1.11.1.22]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Brite
Enzymes [BR:syt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.22  hydroperoxy fatty acid reductase
     SYNGTI_1769 (slr1171)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1937904..1938413
Genome map
AA seq 169 aa AA seqDB search
MTAQANNTIYGFSANALDGSPVALRDFEGKVLLIVNTASQCGFTPQYQGLQALYNRFGDR
GFTVLGFPCNQFGQQEPGGSGEIKNFCETRYGVTFPLFEKVEVNGPNAHPLFKFLTAASP
GMAIPFLGGAEDIKWNFTKFLVDRQGKVVKRYGSIAKPDEIAADIEKLL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccaagccaacaacacaatctacggtttttctgccaatgccttggatggttcc
cccgtagctctgagggactttgaaggtaaagtgctgttaattgtcaacaccgccagtcaa
tgtggcttcactccccaataccaaggactccaggctctatacaatcgattcggcgatcgg
ggttttacggtgcttggttttccctgtaatcagtttggccagcaggaacccggtggctca
ggggaaattaaaaacttttgcgaaacccgttatggagtaacttttcccttatttgaaaaa
gtggaagtcaatggtcccaacgcccatcccctatttaagtttttaaccgcagctagccct
ggtatggccattccttttttgggtggtgcggaggacattaaatggaatttcactaagttt
ttggtcgatcgccaaggtaaagtggtcaaacgctacggttccatcgccaaacccgatgaa
attgcggcggacatcgagaaattgttgtaa

DBGET integrated database retrieval system