KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_1809Help
Entry
SYNGTI_1809       CDS       T01777                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:syt03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981227..1982090
Genome map
AA seq 287 aa AA seqDB search
MPELPEVETVCRGLNRLTLEQTIGGGEVLLDRSLAYPVSVEDFQKQITGCRLVGWQRRGK
YLLGELRSNQAPGPAGWLGCHLRMTGQLLWTERDQQRPRHTRVVLHFEGGWELRFVDTRT
FGKVWLLPGDRPWAEVMTGLGQLGPEPFGADFTAEYLYEKLKSSRRPLKNALLDQRLVAG
LGNIYADEVLFFCGFHPTMASNQVSLQDCELIHQQIQATLTAAIEAGGTSFSDYRQVTGI
NGNYGGMAQVYGREGEPCRHCGTVIAKIKLGGRSAHFCPQCQPKLER
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaactaccagaagttgaaacagtatgccgggggctcaatcgtttgaccctggag
cagaccatcgggggaggggaagtgttgcttgatcgcagtcttgcctaccccgtttctgtt
gaggattttcagaagcaaattaccggttgtcgtttggtgggctggcaacggcggggaaag
tatttgctgggggaacttagaagcaatcaagccccagggccggcgggatggttgggatgc
catttacgtatgacagggcagttactctggacagaacgggatcagcagagaccacgacac
actagggtggtgctccactttgagggcgggtgggagttacgttttgtggatacccgcacc
tttggcaaagtctggctcctaccaggcgatcgcccttgggctgaagtaatgacggggctg
ggacagttggggccagaaccctttggggcggattttacggcggaatatctctacgaaaag
ctgaaatccagtcgccgccctttaaaaaatgccctgctggatcaacggttggtggcaggc
ttgggtaatatttatgccgatgaagtcttatttttttgcggcttccatcccaccatggcg
agtaatcaggtgagtttgcaggactgtgaactgatacatcaacaaattcaagccacttta
acagcggccattgaggctggaggcactagtttcagcgattatcgccaggtgactggtatc
aatggtaattatggcggtatggcccaggtctatggtcgggaaggagaaccctgtcgtcat
tgtggtacagtgatcgccaaaattaaattgggagggcgatcggcccacttttgtccccag
tgtcagccaaaattagagcggtga

DBGET integrated database retrieval system