KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2067Help
Entry
SYNGTI_2067       CDS       T01777                                 

Gene name
xylR
Definition
xylose repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNGTI_2067 (xylR)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTI_2067 (xylR)
   00052 Galactose metabolism
    SYNGTI_2067 (xylR)
   00500 Starch and sucrose metabolism
    SYNGTI_2067 (xylR)
   00520 Amino sugar and nucleotide sugar metabolism
    SYNGTI_2067 (xylR)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNGTI_2067 (xylR)
   00524 Butirosin and neomycin biosynthesis
    SYNGTI_2067 (xylR)
Enzymes [BR:syt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNGTI_2067 (xylR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2281511..2282494
Genome map
AA seq 327 aa AA seqDB search
MLVWLPWGVELARFSQFSLNGMSSPSSIHREVIGIDIGGSSIKFGRFLSNGDCTESLVLP
TPQPALPKAVYAQLAHGIDLLKNSACVAIGVGMPGPADAAGRVAQLAINLPQWHDIPLAD
WLEDHGQLPTVLENDANCAGLGEAWLGAGRDYRNFILLTLGTGVGGAVFLNGKLFTGPQG
AGGELGLISIETEGYPCNSGNRGSLEQHASAQTLRREMNLTGLELAQLAAKGDAEAIAYW
EKFGQRLGMGIANLVYVLTPEAVIIGGGLSASSSYFFPSMASEIEERVLLPSRRGLKILV
AQLGNRAGMIGAARLAWQKLVYRTDGP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtatggctcccctggggggtagaattagcaagattttcccaattttcccttaat
ggcatgagttctccctcttccatacatcgtgaagtcatcggcattgacattggtggttct
tccattaagtttggccggttcctgagcaatggagattgcaccgagtccttggttttgccc
accccccaaccggctttacccaaggcagtttatgctcagttggcccatggtattgacctg
ttgaaaaattcagcttgtgtggcgatcggtgttgggatgccgggaccagcggacgcagca
ggacgggtggcccagttggcaattaatttgccccagtggcacgacattcctttggcggat
tggttggaagaccatggacagttgccgacggtattggagaatgatgccaattgtgctggc
ttgggggaagcttggctcggagcgggcagggattatcgtaattttattttgcttaccctg
ggcacgggggtggggggggcggtgtttttaaatggcaaattgtttacggggccccaagga
gccgggggggaattgggactaatttccattgaaacggaaggctatccttgcaatagcggc
aatcggggttctttggagcaacatgcttctgcccaaaccctacggcgggaaatgaatttg
accggcctggaattggcccaattggccgccaagggggatgcggaggcgatcgcctactgg
gaaaagttcggccagcggttgggcatgggcattgcgaacttggtctatgtgttgacccca
gaggcagtaattattgggggagggctaagcgccagctccagttacttttttccctccatg
gcatcggaaattgaggaaagggtgctattaccttcccgtcggggattaaaaattttggtg
gcccaactgggtaaccgagctggcatgatcggtgcggcccgcctagcctggcaaaagttg
gtttatcgcaccgatggcccttga

DBGET integrated database retrieval system