KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2109Help
Entry
SYNGTI_2109       CDS       T01777                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00500  Starch and sucrose metabolism
syt01100  Metabolic pathways
syt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SYNGTI_2109 (glgB)
Enzymes [BR:syt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SYNGTI_2109 (glgB)
Exosome [BR:syt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SYNGTI_2109 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: BAL29856
Position
complement(2329222..2331534)
Genome map
AA seq 770 aa AA seqDB search
MTYTINADQVHQIVHNLHHDPFEVLGCHPLGDHGKVNQWVIRAYLPTAEAVTVLLPTDRR
EVIMTTVHHPNFFECVLELEEPKNYQLRITENGHERVIYDPYGFKTPKLTDFDLHVFGEG
NHHRIYEKLGAHLMTVDGVKGVYFAVWAPNARNVSILGDFNNWDGRLHQMRKRNNMVWEL
FIPELGVGTSYKYEIKNWEGHIYEKTDPYGFYQEVRPKTASIVADLDGYQWHDEDWLEAR
RTSDPLSKPVSVYELHLGSWLHTAYDEPVKTLHGEGVPVEVSEWNTGARFLTYYELVDKL
IPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRFGSPEDFMYFVDQCHLNGIGV
IIDWVPGHFPKDGHGLAFFDGTHLYEHGDPRKGEHKEWGTLIFNYGRNEVRNFLVANALF
WFDKYHIDGMRVDAVASMLYLDYCREEGEWVANEYGGRENLEAADFLRQVNSVVYSYFPG
ILSIAEESTSWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNSITFSMW
YNHSENYMLALSHDEVVHGKSNMLGKMPGDEWQKYANVRALFTYMFTHPGKKTMFMSMEF
GQWSEWNVWGDLEWHLLNFPPHQQLKQFFTELNHLYKNEPALYSNDFDESGFQWIDCSDN
RHSVVSFIRRAKNSAEFVVTICNFTPQPHSHYRVGVPVPGFYTELFNSDARQYGGSNMGN
LGGKWTEEWSFHEQPYSLDLCLPPLSVLVLKLSQNAEENTVPAEEASNIA
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaccatcaacgctgaccaagtccatcagattgtccataatcttcaccacgat
ccctttgaagtgttgggctgccatcccctcggggaccacggcaaggtcaatcaatgggtc
attcgtgcctatttacccacggctgaagcggtaacggtgttgcttcccaccgatcgccgg
gaagtgattatgaccacggtccaccatcccaacttttttgaatgcgtgttggagttggaa
gaaccgaagaattatcaattaagaattaccgaaaatggccacgaaagggtaatttatgac
ccctatggttttaaaactcccaaactgacggattttgacctccatgtgtttggggaaggc
aaccaccaccgtatttacgaaaaactcggtgctcacctgatgacggtggatggagttaaa
ggggtttattttgctgtgtgggcccccaatgcccgcaacgtttccattttgggggatttc
aacaactgggacggcagattgcaccaaatgcggaaacgcaacaacatggtgtgggaatta
tttatccctgagttgggggtgggcacttcttataagtatgagattaaaaactgggaaggg
cacatctacgaaaagactgacccctacggtttttaccaagaagtacgccccaaaaccgct
tccattgtggcagacttggacggttaccaatggcacgacgaagattggttggaagctagg
cgcaccagcgatcccctgagcaaacccgtttccgtttacgaactccatttaggctcctgg
ttgcacactgcctacgacgaaccggtgaaaactttgcacggggaaggggtgccggtagaa
gtgtccgaatggaataccggggccagatttttaacctattacgagttggtggataaacta
attccctacgtgaaggaattgggttacacccacattgagttactaccgatcgccgaacat
ccctttgatggctcctggggttatcaagtgactggttattacgcccccacttcccgcttt
ggcagtcccgaagactttatgtattttgtcgatcaatgtcacctcaacggcattggtgtg
atcattgactgggtgccggggcattttcctaaggacggccatggcctagccttttttgac
ggaacccatttgtacgaacatggtgatccccgcaaaggtgaacataaggaatggggcact
ctcattttcaactacggccggaacgaagtgcggaacttcctggtggccaatgccctattc
tggttcgacaaatatcacattgacggcatgcgggtggatgcggtggcctccatgctctac
ctagactattgccgagaagaaggggaatgggtggccaatgagtacggcggccgggaaaac
ttggaagcggcagactttttgcgccaggtaaacagcgttgtttacagctacttccccggt
attttatccattgcggaggaatccacctcctggcccatggtgtcctggcccacctacgtt
ggcggcttgggctttaatctgaaatggaatatgggttggatgcacgacatgttggactat
ttcagcatggacccctggttccgccagttccatcaaaacagcattacgttcagtatgtgg
tacaaccacagcgaaaattatatgttggccctgtcccacgacgaagtagtgcacggcaaa
agcaatatgttgggcaaaatgcctggggatgaatggcaaaagtatgccaacgtcagggct
ttattcacctacatgttcacccatcccggcaagaaaaccatgtttatgagcatggaattt
ggccagtggagtgagtggaatgtgtggggtgatttggaatggcatttgctcaattttcca
ccccatcaacaactaaaacaattcttcactgagttgaaccatttgtataaaaatgagccg
gctttatacagcaatgattttgatgaatcgggttttcaatggattgattgcagtgataat
cgccacagtgtagtttccttcattcgtcgggccaaaaatagcgcagaatttgtggttacc
atttgtaattttacgccccaaccccatagccattacagagtgggtgttccggtacctggt
ttctacactgaattattcaacagtgatgcccgacagtacggcggcagtaacatgggcaat
ttaggtggaaaatggacagaagaatggtctttccatgaacaaccctactcgttggattta
tgtttaccgcccctatcggtgttggtattaaaactaagccaaaatgctgaggaaaatact
gtgccagcggaagaggctagcaacatagcttag

DBGET integrated database retrieval system