KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2179Help
Entry
SYNGTI_2179       CDS       T01777                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00010  Glycolysis / Gluconeogenesis
syt00051  Fructose and mannose metabolism
syt00562  Inositol phosphate metabolism
syt00710  Carbon fixation in photosynthetic organisms
syt01100  Metabolic pathways
syt01110  Biosynthesis of secondary metabolites
syt01120  Microbial metabolism in diverse environments
syt01130  Biosynthesis of antibiotics
syt01200  Carbon metabolism
syt01230  Biosynthesis of amino acids
Module
syt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTI_2179 (tpi)
   00051 Fructose and mannose metabolism
    SYNGTI_2179 (tpi)
   00562 Inositol phosphate metabolism
    SYNGTI_2179 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNGTI_2179 (tpi)
Enzymes [BR:syt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SYNGTI_2179 (tpi)
Exosome [BR:syt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SYNGTI_2179 (tpi)
  Exosomal proteins of bladder cancer cells
   SYNGTI_2179 (tpi)
  Exosomal proteins of melanoma cells
   SYNGTI_2179 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Hs1pro-1_N
Motif
Other DBs
NCBI-ProteinID: BAL29926
Position
2421338..2422066
Genome map
AA seq 242 aa AA seqDB search
MRKIIIAGNWKMHKTQAEAQAFLQGFKPLIEDAAESREVVLCVPFTDLSGMSQQLHGGRV
RLGAQNVHWEASGAYTGEISAAMLTEIGIHYVVIGHSERRQYFGETDETANLRVLAAQKA
GLIPILCVGESKAQRDAGETEQVIVDQVKKGLVNVDQSNLVIAYEPIWAIGTGDTCAATE
ANRVIGLIREQLTNSQVTIQYGGSVNANNVDEIMAQPEIDGALVGGASLEPQSFARIVNF
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaatcattattgcgggcaattggaaaatgcataagacgcaggcggaggcccaa
gcgtttttgcaggggtttaaacctttaatcgaagatgcggcggaaagtcgtgaggtggtg
ttgtgtgttcctttcaccgatttgagcggcatgtcccaacaactccatggcggtagggtc
cgcctaggggcacaaaatgtccattgggaagcgagtggggcctacacaggggaaatttca
gcggctatgttgacggaaatcggtattcattatgtggttatcggccacagtgaacgacgg
caatattttggggaaacggacgaaactgccaatttgagagtattggcggcccaaaaggcg
ggcttaattcccattctgtgtgtgggggaaagtaaggcgcaacgggatgccggagaaacg
gaacaggttatcgttgaccaagtgaaaaaaggcttggtgaatgtggatcaatctaaccta
gtcatcgcctacgagccgatttgggccattggtacaggggacacctgtgcggcaacggaa
gccaatcgggttattgggctgattcgggaacagttaactaattcccaggtcaccatccag
tatggcggttcggtcaatgccaacaatgtggatgaaattatggcccaaccggaaattgat
ggagccttggtgggaggagctagtctggaaccccagagctttgcccgcattgttaatttt
cagccctga

DBGET integrated database retrieval system