KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2217Help
Entry
SYNGTI_2217       CDS       T01777                                 

Gene name
sll0019
Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:syt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2466962..2468146)
Genome map
AA seq 394 aa AA seqDB search
MVKRISILGSTGSIGTQTLDIVTHHPDAFQVVGLAAGGNVALLAQQVAEFRPEIVAIRQA
EKLEDLKAAVAELTDYQPMYVVGEEGVVEVARYGDAESVVTGIVGCAGLLPTMAAIAAGK
DIALANKETLIAGAPVVLPLVEKMGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGG
AFRDLPVERLPFVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDHIDI
VIHPQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWEPLDLVKAGSLSFR
EPDHDKYPCMQLAYGAGRAGGAMPAVLNAANEQAVALFLQEKISFLDIPRLIEKTCDLYV
GQNTASPDLETILAADQWARRTVLENSACVATRP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaacgcatttctatcctcggctccaccggttccattggtacccaaactctggac
attgttacccatcatcctgatgcttttcaggtggtcggtttagcggctgggggaaatgtt
gcattactagcccaacaggtggcggagtttcgcccagagattgttgcgattcgtcaggca
gaaaagttagaggacctaaaagcagcagtggccgaactaactgattaccaacccatgtac
gtggtgggggaagaaggggtggtggaagtggcccgttatggtgatgcagaaagtgtggtc
acaggtattgtcggttgtgcgggattattacccaccatggcggcgatcgccgccgggaaa
gatattgctttagccaataaggaaacgttaattgccggagctccggtggtgttacccctg
gtggaaaaaatgggggtgaagttattgccggcggattcagaacattcagccatttttcaa
tgtttacagggggttcccgaaggggggttacggcggatcattctcaccgcttccggggga
gcattccgggacttgccggtggaaagattaccgtttgtaacagtacaggatgccctcaaa
catcccaactggtctatgggacaaaaaatcaccattgattccgccacattgatgaacaag
ggtttggaggtgattgaagcccattatctatttggcttggactacgatcatatagacatt
gtcattcatccccaaagcattattcattctttaattgaggtgcaggatacttctgtgcta
gctcaactggggtggcctgatatgcgtttgccgttgctctatgccctatcttggccagaa
agaatttacaccgactgggaacctttggatttagttaaagccggtagcttgagttttcgg
gagccagatcacgataaatatccctgcatgcaattggcctatggggccgggcgagctggg
ggagccatgccagcggtgttaaatgcggccaatgaacaggcggtggctttatttttgcaa
gaaaaaattagctttttggatattccccgtctgattgaaaagacctgtgacctctacgtt
ggtcaaaatactgctagccctgatttagaaacaattttggcagcggatcaatgggcccgg
cggacggtgttggaaaatagcgcctgtgtggctactcggccataa

DBGET integrated database retrieval system