KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2737Help
Entry
SYNGTI_2737       CDS       T01777                                 

Gene name
slr0795
Definition
hypothetical protein
Orthology
K11331  
cation efflux system protein involved in nickel and cobalt tolerance [EC:3.2.1.17]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:syt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SYNGTI_2737 (slr0795)
Enzymes [BR:syt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SYNGTI_2737 (slr0795)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3052590..3053417
Genome map
AA seq 275 aa AA seqDB search
METTLLLLCVTIGSALKNRIFKRELLSLLAVLTTVGEIFLPHFFWLISMTITQNTTRHYH
HRRRSQQSSWSRHFFLATLLFTLCLAAFIRKSPETENINSFFGHLPSLAMEGGDPYIRAL
MRTISASESNAKNPYVLLYGGQHTHDLSRHPNACIAIKTDVNQGHCSTAAGRYQFLTKTW
QEKAALYHPQRHLGKSHYNFEPEFQDLVTYRWLTDKHHWGMDFSTQLQQGNIEQVLKKLS
GTWTSLGYGIEDNRMTASLPKIYQKLLAEELDQAN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagaccacattgctccttttgtgcgtaacgatagggtcagcactcaaaaatcgcatt
tttaaacgtgaattattatctcttctggctgtattaacaacggtgggagagattttttta
ccacattttttctggttaatttccatgaccattacccaaaacacaactcgccactatcat
catcgtcgaaggtctcaacaatcatcttggtcacgccatttttttctggccactttatta
tttactctttgcttggcagcttttattagaaagtctcctgaaactgaaaacatcaattcc
ttttttggccatttaccatccctagccatggaaggaggagatccttacattagagcttta
atgcggacaatttcagccagtgaatctaatgctaaaaatccctacgttttactctatggc
ggtcaacatacccatgatttaagtcgccatcccaatgcttgtattgccatcaaaacagat
gttaaccaagggcattgctccacagcggcaggacgttatcaatttttgactaagacttgg
caggaaaaagcggctttgtatcaccctcaacgtcatttgggaaaatcacactataacttt
gagcctgaatttcaggatttagtaacctatcgatggttgaccgataaacaccactggggc
atggacttttccacccaattacaacagggaaatatcgaacaagtgttgaaaaaactttct
ggcacttggacaagtttgggttacggcattgaagacaatagaatgaccgcttctttaccc
aaaatttatcaaaaactattagcagaagaacttgaccaagctaattaa

DBGET integrated database retrieval system