KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2806Help
Entry
SYNGTI_2806       CDS       T01777                                 

Gene name
pfkA
Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00010  Glycolysis / Gluconeogenesis
syt00030  Pentose phosphate pathway
syt00051  Fructose and mannose metabolism
syt00052  Galactose metabolism
syt00680  Methane metabolism
syt01100  Metabolic pathways
syt01110  Biosynthesis of secondary metabolites
syt01120  Microbial metabolism in diverse environments
syt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTI_2806 (pfkA)
   00030 Pentose phosphate pathway
    SYNGTI_2806 (pfkA)
   00051 Fructose and mannose metabolism
    SYNGTI_2806 (pfkA)
   00052 Galactose metabolism
    SYNGTI_2806 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SYNGTI_2806 (pfkA)
Enzymes [BR:syt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYNGTI_2806 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SYNGTI_2806 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAL30553
Position
complement(3122763..3123917)
Genome map
AA seq 384 aa AA seqDB search
MGTKRIGILTSGGDCPGLNAVIRAVVKASALKGWEVYGIPYGTDGFVEVAHGKYQAEDLL
LTKHGYALPGMLKGLDVLQFLSGSVLGSLSKGHPEQPAIAEAILKGYAILDLEALIVIGG
DGSLDIIYDLAQKGNWHIIAIPKTIDNDVPFTDLAVGFSTAVDIVTQALYDLTFTAASHE
RIIIVQVMGRDAGHLTLHAGIAGGADIILIPEITPCLTSEIIRNCCYQLMNLRKSGRHFA
LIVISEGVHDQNNKKNKHIADYLAEEISETSQHLCDIKDPAFCDLISLDIRATTLGHLQR
SGTPLSFDRLLATVFGIRAVELIEQEIYDQVVIWRSGKVEHADLKPIISIIKECHQENRC
PFPVDRDGFMVKTAKSLGIYLGED
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggcacaaaacgtattggaattttgaccagtggtggtgattgtcctggcctcaatgcc
gtcatccgagcagtggttaaggcctcagctcttaaggggtgggaggtttatggtattccc
tacggcaccgatggttttgttgaagttgcccacggaaaataccaggcagaggatttactg
ttaactaaacatggctatgctctgcccgggatgctcaaaggcttagatgtattgcaattt
ctcagcggtagtgttttagggtccttaagtaagggacatccagagcaaccggcgatcgcc
gaagccattctcaagggttatgccatacttgacctggaagcactaattgttattggtggc
gatggtagtttagacattatttatgatttagcccaaaaaggtaattggcatattattgcc
attcccaaaaccattgacaatgatgtgccctttacggatctggcagtgggatttagcact
gcggtggatattgttacccaagccttatacgacctgacttttaccgccgctagccatgaa
cgcattatcattgtccaggtcatggggcgggatgcggggcatttgactctccatgcaggc
attgccggcggagctgatatcattttaattcccgaaattaccccttgtttgacttctgaa
attatccgcaattgttgttatcaactaatgaatttgcggaagtctggccgccattttgct
ttaatagttatttcagagggtgtccacgatcaaaataataagaaaaataaacatatcgcc
gactacttagcagaagaaatcagtgaaaccagtcaacacctttgcgacattaaagatccc
gctttttgcgatctaataagtctagacattcgagccacaaccctgggtcatttacaacgg
agcgggacccccctatcgttcgatcgcctcttggccacggtgtttggaattagggcagtg
gagttgatcgaacaggaaatttatgaccaggtggtgatctggcgcagtgggaaggtggaa
cacgctgaccttaaaccaattatcagcatcattaaagaatgtcaccaggaaaatcgctgt
cctttcccggtggatagggatggttttatggttaaaacggccaagtcattgggcatatac
ctaggagaagactaa

DBGET integrated database retrieval system