KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2899Help
Entry
SYNGTI_2899       CDS       T01777                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syt01100  Metabolic pathways
syt01110  Biosynthesis of secondary metabolites
syt01130  Biosynthesis of antibiotics
syt01230  Biosynthesis of amino acids
Module
syt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNGTI_2899 (trpC)
Enzymes [BR:syt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SYNGTI_2899 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: BAL30646
Position
3237899..3238786
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPPIKVDILQYQIKHPEAAPRHILEEIVWHKEKEVAQRRELVPLVKLQSLVK
DMTPPLDFVGALRQSPRQPALIAEVKKASPSKGIIRADFDPVAIAKAYEAGGANCLSVLT
DEKFFQGSFENLQLVRSAVQLPLLCKEFIIYPYQIYLARSRGADAVLLIAAILSDKDLRY
FLKIIEGLGMAALVEVHTLEEMDRVLALDGVQLIGVNNRNLQTFTVDLQTTEDLFAQRRE
QLTQGDITLVSESGIYELADLQRLQQAGARAVLVGESLVKQPDPQQAIAALYGEV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgccgccggcctcctaacccccccatcaaagttgacattcttcagtatcaa
attaagcatccagaagcggctccccgtcacattctggaggaaattgtttggcataaggaa
aaggaagtggcccaacggcgagaattagtccccctggtcaaactccaaagtttagtcaag
gacatgactcccccattggattttgtgggggcattgcgccagagtccccggcaaccggcc
ttaattgctgaagtgaaaaaggcttcccctagtaagggcattattcgggcggattttgac
ccagtggcgatcgccaaggcctatgaagcgggaggggctaactgtttatcggtgttgacg
gacgagaaatttttccagggtagttttgaaaatttgcaactggtacgctcagcggtgcaa
ttacccttgctgtgcaaggaatttattatttacccctatcaaatctatctagcccggagt
cggggggccgatgcggtgctgttaattgccgctatcctcagcgataaggatttgcgttat
ttcctcaaaattattgaaggtttgggcatggcggcgttggtggaagtccataccctggag
gaaatggaccgggttttggctttggacggggtgcaactaatcggagttaataaccgtaat
ttgcaaaccttcaccgttgatctgcaaaccacagaggatctttttgcccaacgacgggag
caattaacccaaggggacattactttagtgagcgaatccggcatttatgaattggctgat
ttgcaaagattacagcaggctggggcccgggccgttttagtcggcgaatccctggtcaaa
caaccagatccccaacaggcgatcgccgctttatacggtgaagtttaa

DBGET integrated database retrieval system