KEGG   Synechocystis sp. PCC 6803 GT-I: SYNGTI_2928Help
Entry
SYNGTI_2928       CDS       T01777                                 

Gene name
gap2
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (NADP+)(phosphorylating)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syt  Synechocystis sp. PCC 6803 GT-I
Pathway
syt00010  Glycolysis / Gluconeogenesis
syt00710  Carbon fixation in photosynthetic organisms
syt01100  Metabolic pathways
syt01110  Biosynthesis of secondary metabolites
syt01120  Microbial metabolism in diverse environments
syt01130  Biosynthesis of antibiotics
syt01200  Carbon metabolism
syt01230  Biosynthesis of amino acids
Module
syt_M00002  Glycolysis, core module involving three-carbon compounds
syt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syt_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTI_2928 (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNGTI_2928 (gap2)
Enzymes [BR:syt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     SYNGTI_2928 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N NAD_binding_3 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: BAL30675
Position
complement(3275839..3276852)
Genome map
AA seq 337 aa AA seqDB search
MTRVAINGFGRIGRNFLRCWLGRTDSQLEVVGINDTSDPRTNAHLLRYDSMLGKLDADIS
ADENSITVNGKTIKCVSDRNPLNLPWAEWNVDLVIEATGVFVTHEGATKHVQAGAKKVLI
TAPGKGPNIGTYVVGVNAHEYKHEEYEVISNASCTTNCLAPIAKVINDNFGIIKGTMTTT
HSYTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVALVIPELQGKLNGIALRVPTPN
VSVVDLVVQVEKNTIAEQVNGVLKEAANTSLKGVLEYTDLELVSSDFRGTDCSSTVDGSL
TMVMGGDMVKVIAWYDNEWGYSQRVVDLAEIVAKNWK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgactagagtagcaattaacggatttggacggatcggacgcaactttctccgttgctgg
ctggggcgcaccgatagccagttagaagtagtcggtatcaacgacacctctgatcccaga
accaatgctcaccttttgcgctacgactccatgttgggtaagttggatgcggacatcagt
gccgacgaaaactccattaccgtcaatggcaagactattaaatgtgtttccgaccggaat
cccctcaatttgccctgggcagaatggaatgtagatctagtcatcgaagccaccggtgtt
tttgttacccatgaaggggccaccaagcacgttcaagccggagccaaaaaagttttaatc
actgctcctggcaaggggcccaacatcggcacctatgtggtgggggtcaatgcccacgaa
tataagcacgaagaatacgaagtaattagtaacgctagttgtactaccaactgcctcgcc
ccgatcgccaaagtaatcaacgacaattttggcatcatcaaaggcaccatgaccaccacc
cacagctacaccggagaccaacggatcctcgatgctagccaccgggatctacgccgggcc
cgggctgctgccgttaacatcgtgcccacctccaccggagctgccaaagcggtggccctg
gtaattcctgaactgcaaggcaaattgaacggtattgccctgcgggtgcccacccccaac
gtttccgtggtggatttggtagtacaagtagagaaaaacaccatcgctgaacaggttaac
ggagtgctcaaagaagcagccaacaccagccttaaaggagtgttggaatacaccgatttg
gaattggtttccagcgacttccggggcacggattgctcttccactgtggatggtagtctg
accatggtaatgggcggtgacatggttaaagtcattgcttggtacgacaacgaatggggc
tattcccaacgggtggtggacttggctgaaattgtggctaaaaactggaaatag

DBGET integrated database retrieval system