KEGG   Synechococcus sp. WH8102: SYNW0030Help
Entry
SYNW0030          CDS       T00144                                 

Gene name
gap2
Definition
glyceraldehyde 3-phosphate dehydrogenase (NADP+) (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNW0030 (gap2)
   01230 Biosynthesis of amino acids
    SYNW0030 (gap2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNW0030 (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNW0030 (gap2)
Enzymes [BR:syw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     SYNW0030 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
30250..31275
Genome map
AA seq 341 aa AA seqDB search
MTLRVAINGFGRIGRNVMRGWISRGADTGLEIVGMNSTSDPKTSAHLLTYDSILGKLDPS
VKIETTDDTMLVNGKEIKFFADRNPLNCPWKDWGVDLVIESTGVFNTDEKASMHLEAGAS
KVILTAPGKGDGVGTFVVGVNDDQYRHEDWNILSNASCTTNCLAPIVKVLDQNFGLDWGL
MTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAVALVYPEVKGKLTGFAMRV
PTPNVSAVDLTFGPSRATSVDEVKAVIKAASENGMKGIIKYSDLPLVSTDYAGTNESTIF
DADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVARNWK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgttgcgatcaatggattcggccgaattggtcgcaatgtgatgcggggt
tggatcagccgtggtgctgatacgggcctggagatcgtgggtatgaactccacgtccgat
cccaagaccagcgctcacctgctgacctacgactcgatccttggcaagctcgatcccagc
gtcaagatcgaaaccaccgacgacaccatgctggtcaacggcaaggagatcaagttcttc
gctgaccgcaaccccctgaactgcccttggaaggactggggtgtcgatctggtgatcgaa
tccactggtgtgttcaacaccgacgaaaaagccagcatgcacctcgaggcaggcgccagc
aaggtgatcctgactgcccctggcaaaggtgatggcgtcggcactttcgtggtgggagtc
aatgacgaccagtaccgccatgaggactggaacatcctctccaacgccagctgcaccacc
aactgcctggcccccatcgtcaaggttctggatcagaacttcggcctcgactggggtctg
atgaccaccatccacagctacaccggcgaccagcggatcctggacaacagccaccgcgac
ctgcgtcgcgcccgtgctgctgctctgaacatggtccccaccaccaccggtgcggccaag
gctgtggccctggtataccccgaggtgaagggcaagctcaccggtttcgccatgcgcgtt
cccacccccaacgtatctgccgttgacctcaccttcggaccgtcccgtgccaccagcgtt
gatgaggtgaaggctgtgatcaaggccgcttctgagaacggcatgaagggcatcatcaag
tacagcgacctgcccctggtctccaccgattacgccggcaccaacgaatccacaatcttt
gatgccgacctcacctacgcgatgggcgacaaggctgtgaagatcctggcctggtacgac
aacgagtggggttacagccagcgcgttgttgatctggctgaagtggtggcccgcaactgg
aagtga

DBGET integrated database retrieval system