KEGG   Synechococcus sp. WH8102: SYNW0196Help
Entry
SYNW0196          CDS       T00144                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNW0196
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SYNW0196
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SYNW0196
Enzymes [BR:syw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SYNW0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
199343..201592
Genome map
AA seq 749 aa AA seqDB search
MTASFRHGVASGDPYQDSFVIWSRVSDVDGSSASVNWEVSSSPKFKKRTILDSGTISTSS
DRDWTVKALPEGLQAGEDYYYRFEVDGVVSPVGHASTLPDKAASVRMAVLSCANFTNTEF
FETYRRVAEIDAEQPYDIILHVGDYIYEYGQGGYPSAESAVENRGFEPDSELLSLDDYRQ
RYAQYHSDAGLREMHASAPMVSIWDDHETANDSWLGGAENHQSEVEGDWASRRDAALQAY
YEWMPIREPALRRDVDLGTDDSPLTQGFRSFDLADLVTLYVLETRLTARDEQLAYPNSDA
VAARIGDILADPLLLASYAESLGVAPPVSAEDLDGVNALSAALIDPVTLELVAATVADGW
TNPSRNLLGQDQQSWLQSGLAGSDAAWQVLGQQVLMQSMAIPAELLLNATDPDVLAKYSA
PLEKLATGQPLNQDELALFDEATKIPYNLDAWDGYGVERETILQTAAGLGKKLVSLAGDT
HNAWVGVLDAMSTGAAMPGQVVGIEFATPGVSAPGIETYIAPGLEPIFLSYTEGLKYTDL
SRRGFLDITFHEEHITSSYQLLDPDEGWIADVLQSDDSFSPRQLSRVDATTTADIPTGFA
HGRFREVIRAGAGNDRIAAGDRKGYVSAGGGNDDIDGGRRAQLLLGDEGDDVIRGRGGPD
ELRGGPGADSLNGGPGDDLILGGAGADSFRISKGDDRIVDLDPLEGDVLLLPAGLEPTLT
SAVSGVLLATDRGTTLLEGLTLEQVEGLI
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcatcctttcggcatggtgtcgcctcgggtgatccctatcaggattcctttgtg
atctggtcacgcgtgtctgatgtggatggctcgtctgcatctgtgaactgggaagtctct
tcaagtccgaaatttaaaaaacgtacaattttggattcgggaacgatttccacaagttcg
gatcgagattggactgtcaaggcacttcccgagggattgcaggctggtgaagactattac
taccgcttcgaagtggatggggtggtatctcctgtaggtcacgccagtacgttgcctgat
aaggctgcttcagtccgtatggcagttttgtcatgcgctaattttacaaatacggaattt
tttgagacctatcgaagagtcgcggaaatcgatgctgagcagccctacgatattatttta
catgttggcgactatatttatgaatatggtcaaggcggttatccgagcgcagagtctgct
gttgaaaaccgtggctttgagcccgatagcgagttgctgagtcttgacgattatagacag
cgttatgcgcagtaccacagtgatgctggtttacgtgaaatgcatgcatctgctccaatg
gtctcgatctgggacgaccacgaaactgctaatgacagttggttaggaggtgctgaaaat
caccagtctgaagtcgagggtgattgggcctctcgtcgtgatgctgctctgcaggcttac
tacgagtggatgccgattcgagagcctgctttgcgtcgggatgttgatttggggacggat
gattcgcctctgactcagggttttcgcagttttgacctggctgatcttgttactctttat
gtacttgagactaggcttacggcaagggatgagcagcttgcttatccaaattctgacgct
gtcgccgctcgaattggggacatactcgcggatccactgctattagcttcctacgccgag
tctctgggtgttgctccccccgtttcagcggaggaccttgatggcgtcaacgctttatct
gcagccttgatcgatccagtgaccctggagttggttgcggcgactgttgccgatgggtgg
acgaatccatctcgaaatctccttggtcaagaccagcagtcctggctccagagtggcttg
gccgggtctgatgctgcttggcaggtgcttggtcagcaggtcttaatgcagtcaatggct
ataccagctgagctgctgctgaatgccacggatccagatgttctggcgaagtattcggcc
ccccttgaaaagttggcgactggacagcccctgaatcaagacgagttggctttgtttgat
gaagctactaagattccatacaaccttgatgcttgggatggctacggcgttgagagagaa
accattcttcaaacggcagccggtctcggtaaaaagttagtttcccttgctggtgataca
cacaacgcatgggtaggtgtgctggacgcgatgagtacaggtgcggctatgcctggccaa
gtggtcggcattgaatttgccactccaggagtttctgctccaggaatagaaacatacatt
gccccaggtctcgagccaatatttttaagttacacagaaggtttaaaatatacagactta
agtcggaggggtttccttgatattacctttcacgaagaacacatcacttctagctatcag
cttctagaccctgacgagggttggatcgccgatgttttgcagtcagatgattccttcagc
ccacgccaactatcccgggttgatgccacgacaactgcagatatcccaaccggatttgcc
cacggaaggttcagagaagtcatccgggctggtgctggcaatgaccgcatcgcagctgga
gatcgcaaaggttatgtctccgctggaggtggtaacgatgacatcgacggtggccgtcgc
gcacaactgctcctcggtgatgagggtgatgatgtgattcgtggtcgtggtggccctgac
gagctcaggggtggtcccggcgcagacagcctgaatggtggtcctggtgatgatttgatt
cttgggggcgctggtgcggacagtttccgcatcagcaaaggagacgaccgcatcgtcgac
cttgatcctcttgaaggagacgttctgctcttgcctgcaggcctcgagccaacgttgact
tcggctgtttctggcgtccttctcgcgactgatcgtggcaccaccctgttggagggactc
accctggagcaggtggaggggctgatctga

DBGET integrated database retrieval system