KEGG   Synechococcus sp. WH8102: SYNW0202Help
Entry
SYNW0202          CDS       T00144                                 

Gene name
psbL
Definition
(RefSeq) photosystem II reaction center L
  KO
K02713  
photosystem II PsbL protein
Organism
syw  Synechococcus sp. WH8102
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    SYNW0202 (psbL)
Photosynthesis proteins [BR:syw00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    SYNW0202 (psbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(206598..206717)
Genome map
AA seq 39 aa AA seqDB search
MQRNPNPNNLPVELNRTSLYLGLLFVFVTGVLMSSYFFN
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcaaccccaaccccaacaacctgccggttgaactcaaccgcaccagcctttat
ctgggcctgctgtttgtgttcgtcaccggcgtgttgatgtccagctacttcttcaactaa

DBGET integrated database retrieval system