KEGG   Synechococcus sp. WH8102: SYNW0213Help
Entry
SYNW0213          CDS       T00144                                 

Gene name
chlD
Definition
protoporphyrin IX magnesium chelatase subunit ChlD
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNW0213 (chlD)
Enzymes [BR:syw01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SYNW0213 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(213608..215716)
Genome map
AA seq 702 aa AA seqDB search
MVASGVAVTDDRATRAFPLAAITGHGTLKLALLLAAVDPGLGGVVIAGGRGTGKSVLARG
LHALLPPIDILDVDNGVGRNLDPQNPEEWDDTTRERISGEPPSKVIPAPFVQIPLGITED
RLVGALDVAASLASGSAVFQPGLLADAHRGVLYVDELNLLDDGIVNLMLAAVGSGENRVE
REGLSLSHPCRPLLIATYNPEEGNVRDHLLDRFAIALSANQVVSTEQRVEITGAVLSHGQ
CSRSFAQKWGEETDALATQLLLARQWLPDVLISREQIEYLVTEAIRGGVEGHRSELYAVR
VARAHAALSGRDTVEADDLQVAVALVIAPRASQMPPPDQQMEPPPPQDQEPPPPPQDQGD
QQQDNPPPPPEGSDEEDSDPPEDSNDDNDTEDDDGDGEEDQAPPAVPEEFILDPEAIEVD
PDLLLFNAAKAKSGNSGSRSVVLSDSRGRYVKPMLPRGPVRRIAVDATLRAAAPYQKIRR
EREPGRSVIVEEGDLRAKLLQRKAGALVVFLVDASGSMALNRMQSAKGAVIRLLTEAYEN
RDEVALIPFRGDQAEVLLPPTRSITAARRRLESMPCGGGSPLAHGLTQAARVGANALATG
DLGQVVVVAITDGRGNVPLSTSLGQPELEGEEKPDLKQEVLDVASRYRMLGIKLLVIDTE
RKFIGSGMGKDLAEAAGGKYVQLPKASDQAIAAVAMNAINDI
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaagcggtgttgcggtgaccgacgaccgggcgacccgagcctttcccctggcc
gccatcacaggccacggcaccctcaagctggcgctgttgctggcggcggttgatccaggc
ctcggcggcgtggtgatcgccggcgggcgcggcaccggtaaatccgttctggcccgtggc
ctccatgcgctgttgccgcccatcgacatcctcgatgtcgacaacggcgtcggtcgcaac
ctcgatccgcagaaccctgaggagtgggatgacaccacccgggagcgcatcagcggtgag
cccccctccaaggtgatcccagcaccttttgtgcagatccctctggggattaccgaagac
aggttggtgggtgcgctggatgtggccgcgtccttggccagcggcagcgccgtgttccag
ccgggtttgctggcggatgcccaccgcggcgtgctctatgtcgatgaactgaacctgctg
gacgacggcatcgtcaatttgatgctggcggccgtgggcagcggcgaaaaccgggtagaa
cgggaaggcctcagcctcagccacccctgccggcccctgttgatcgccacgtacaacccg
gaggaaggcaacgttcgcgatcacctgctcgatcgcttcgccattgcgctctcggccaac
caagtggtgagcaccgagcagcgggtggagatcaccggcgccgtgctcagccacggccaa
tgcagccgcagctttgctcagaagtggggcgaggagaccgatgccctggccacccagctg
ctgctggctcgccagtggctgccggatgtgttgatcagtcgcgagcagatcgaatacctc
gtcaccgaggcgatccgcggcggtgtggagggacatcgctccgagctttacgcggttcgg
gtggcccgggcccatgccgccctctccggccgcgacaccgtggaggccgacgatctgcag
gtggccgtggctctggtgatcgcaccgcgggcctcccagatgccgccaccggaccagcaa
atggaaccaccgccgccgcaggaccaggagcctccaccaccgccccaggaccagggcgat
caacagcaagacaacccgcccccaccaccggagggctccgatgaggaggacagcgatcct
cctgaggacagcaacgacgacaacgacacggaagacgacgacggtgacggcgaagaggat
caggcccctccagccgttcccgaagagttcattctcgacccggaggcgatcgaggtggat
cccgatctgctgctgtttaatgccgccaaggccaagagcggcaacagcggcagccgatcg
gtggtgctcagcgacagccgcggccgctacgtgaaaccgatgctgccgcgcggaccggtg
cgccgcatcgccgtggacgccaccctgcgggcggctgcgccataccagaagatccgtcga
gagcgagaaccaggccgttcggtgatcgtggaagaaggcgacctccgcgccaagttgctg
cagcgcaaggccggcgccctggtggtgttcctggtggatgccagcggttcgatggccctg
aatcggatgcaaagcgccaagggtgccgtgattcgactgctcactgaggcctacgaaaac
cgcgacgaggtggccctgatccccttccgcggcgatcaggccgaggtgttgctgcccccc
acccgctcgatcacagccgcccgccggcggctggaatcgatgccctgtggcggtggttca
ccgctggcccatggcctcacccaggcggcccgcgtcggcgccaatgcactggccacaggg
gatctcggccaggtggtggtggtggccatcacggacggccgaggcaacgtgcccctgagc
acctccctgggccaacccgagctggagggcgaggagaaacccgacctgaagcaggaggtg
ctggacgtggccagccgctaccggatgctcggcatcaagctgctggtgatcgacaccgag
cgcaagttcatcggcagcggcatgggcaaggacctcgccgaagcggctggaggcaaatac
gtgcaactgcccaaggccagcgatcaggcgattgcggcggtggcgatgaatgccatcaac
gacatctga

DBGET integrated database retrieval system