KEGG   Synechococcus sp. WH8102: SYNW0216Help
Entry
SYNW0216          CDS       T00144                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syw  Synechococcus sp. WH8102
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNW0216 (folK)
Enzymes [BR:syw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SYNW0216 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
216407..216898
Genome map
AA seq 163 aa AA seqDB search
MSVAPTAGNDLGVALGANRSSAVGSPRATLLAVRPLLEEQVQVWSSQALGFRWSELHDTT
PVGGPPDQPCYCNAVLLVEGLKAPPGEAAALQLLDALQGLEQQFGRDRSLEQRWGPRSLD
LDLLFWGEFRLEHPRLLLPHPRLHLRTFVLAPLLEAMQGSASR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgttgcgcccactgccggcaacgacctgggggttgccctgggggccaaccgatcc
agtgcggtgggatcaccccgcgccacgctgctggcggtgaggccactgctcgaggagcag
gtgcaggtctggtcctctcaggctcttggttttcgctggtcggagctgcatgacaccacc
cctgtcggtggcccccccgatcagccctgttactgcaatgcggtgctgctggtggagggg
ctgaaggccccgccgggcgaggcagccgccctgcaattgctggatgcgctgcaggggttg
gagcagcagttcggccgcgaccgatcgctggaacagcgttggggtccccgcagcctcgat
ctagacctgctgttctggggggagttccggctggagcacccgcggctgctcttgcctcac
ccccgcctgcacctcaggacgttcgtgctggcgccgctgctggaggcgatgcaggggtcg
gcgtcacggtga

DBGET integrated database retrieval system