KEGG   Synechococcus sp. WH8102: SYNW0292Help
Entry
SYNW0292          CDS       T00144                                 

Gene name
gatC
Definition
aspartyl/glutamyl-tRNA amidotransferase subunit C
Orthology
K02435  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
syw  Synechococcus sp. WH8102
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:syw00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(292355..292648)
Genome map
AA seq 97 aa AA seqDB search
MSRISADDVRKVAKLARLDLPEEKIATYTGQLESILEYVGQLESIDTEGVPETTRAVEVT
NVTREDGVTPTPVREDILNQAPQREGDFFRVPKILAD
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatctccgctgacgacgtacgcaaagtggccaagctggcccgccttgatctg
cctgaagagaagatcgccacctacaccggtcagctggagtcaatcctcgagtacgtcggt
cagctggaaagtattgataccgaaggcgttcctgaaaccacccgcgccgtggaggtcacc
aacgtgacccgtgaggatggcgtcaccccaactcccgtccgagaggacatcctgaatcaa
gctccccagcgggagggggatttcttccgcgtcccgaaaattctggcggattga

DBGET integrated database retrieval system