KEGG   Synechococcus sp. WH8102: SYNW0296Help
Entry
SYNW0296          CDS       T00144                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00240  Pyrimidine metabolism
syw00250  Alanine, aspartate and glutamate metabolism
syw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SYNW0296 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SYNW0296 (pyrB)
Enzymes [BR:syw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SYNW0296 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAE06811
JGI: SYNW0296
CyanoBase: SYNW0296
CYORF: SYNW0296
UniProt: Q7U9G2
Position
295018..296067
Genome map
AA seq 349 aa AA seqDB search
MSGWHHRHILDLAAFSREDYAAVLDLAERFRSLPVTGARKLPALQGRLVATLFFEPSTRT
RSSFELAAKRLSADVQSFSPSSSSLSKGESVLDTARTYVAMGADVLVVRHRSTGVPQQLA
EDLESAGERTVVLNGGDGLHSHPSQGLLDLHTLARHFAPQHPMPEALQGRRIVIVGDILH
SRVARSNLWALTACGADVVLCGPPSLVPDAFRAFVEAPPPGQSADPVPQRGSVRVERRLE
RALPGADAVMTLRLQKERMTQQLLTGLERYHRDFGLSHERLSLCGQPVPVLHPGPVNRGV
EMTGALLDDPSICLVEEQVRNGVPIRMALLYLMAAAESAAESTLVSISS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcggttggcaccatcgccacattctcgatctggcggccttctccagggaggattac
gccgccgtgctcgatctggctgagcggtttcgttccctgcctgtcaccggtgcccgcaaa
ctcccggctttgcagggccgtttggtggcgaccctgttcttcgagcccagcacccgcacc
cgcagcagctttgagctggccgccaagcgcctctccgctgatgtgcagagtttttcgccc
tccagcagctctctgagtaaaggggaaagcgtgctggatactgcccgcacctatgtggcg
atgggcgcggatgtgttggtggtccgtcatcgttccaccggggttccccagcaattggcg
gaggatctggagtcggcaggggagcgcacggtggtgctgaacggcggtgatggcctgcac
agccatcccagccagggattgctggatctgcacaccctggcccgtcacttcgcaccgcag
catccgatgccggaagccttgcaggggcgacggatcgtgattgtcggcgacatcctgcac
tcccgggtggcccgctccaatctctgggccctcaccgcctgcggtgctgatgtggtgctc
tgcggcccgccgagtttggtgcctgacgccttccgtgcgttcgtggaggctccgccgcca
gggcagtctgcggatccggttccacagcgcggatcggtgcgggtggagcggcgtctggag
cgtgccttgcccggcgcggatgcggtgatgacgctgcgtctgcagaaggaacggatgaca
cagcagctgctgacggggttggagcgctaccaccgcgatttcgggctgagccatgagcgg
ctcagcctgtgcggccagccagtgccggtgcttcatcccggtccggtcaaccgtggcgtt
gagatgaccggagcgctgctggatgatccgtcgatctgtctggtggaggagcaggtgcgg
aacggtgtcccgatccgcatggccttgctttacctaatggctgcggctgaatcggctgcg
gaatcgaccctggtatcaatcagctcctga

DBGET integrated database retrieval system