KEGG   Synechococcus sp. WH8102: SYNW0652Help
Entry
SYNW0652          CDS       T00144                                 

Definition
methionine salvage pathway protein E-2/E-2'
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
syw  Synechococcus sp. WH8102
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SYNW0652
Enzymes [BR:syw01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     SYNW0652
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     SYNW0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(637606..638166)
Genome map
AA seq 186 aa AA seqDB search
MSRLSIFPDHGDGGDGALPLPKLVCNDPASIQAELADRCVGFEQWPAAHALPPDADQSTI
LTTYASEVARVQRDGGYQTVDAIRMTPDHPEREALRNKFLSEHTHAEDEVRFFVEGQGLF
SLHIDKEVLVTLCERGDLISVPAGTRHWFDMGPTPSFCALRFFNNSEGWVATFTGDSIAE
RFPRLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtctcagcatctttccagaccacggggatggcggtgatggcgcccttccactg
ccgaagctggtctgcaacgacccagcctcgatccaggctgaactggccgaccggtgtgtc
ggctttgagcagtggcctgctgcccatgccctacccccagatgccgatcagagcacgatc
ctgacgacctacgcctcagaggtggccagggtccagagggatggtggttatcaaacggtg
gatgccatccgaatgacgccggatcacccggagagggaggctctgcgcaacaaattcctg
tcggaacacacccacgccgaagacgaggtgcgctttttcgttgagggccaggggctgttc
tcgttgcacatcgacaaggaggtgctggtgacgctgtgtgaacgcggcgacctgatcagc
gtcccggccgggacccgccactggttcgacatgggaccaaccccatcgttctgcgccctg
cgctttttcaacaacagcgaaggctgggtcgcgaccttcacgggcgactccatcgctgag
cgttttccacggctcgactga

DBGET integrated database retrieval system