KEGG   Synechococcus sp. WH8102: SYNW0671Help
Entry
SYNW0671          CDS       T00144                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNW0671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNW0671
   00020 Citrate cycle (TCA cycle)
    SYNW0671
   00620 Pyruvate metabolism
    SYNW0671
Enzymes [BR:syw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SYNW0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
655000..656325
Genome map
AA seq 441 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAV
LMPAGSTAPVGETIGLIVETEAEIADAQAKATSAAPAASAPAPTPAPAAVQAPAPTPAPT
QAPAAPAPVAASAAPVANGRVVASPRAKKLASQMGVDLSTVRGSGPHGRIQAEDVEQAGG
QPISVPRVAEGTAAAVAASAAPSAAAPSAPAGNSFGRPGDTVAFNTLQGAVNRNMEASLA
VPCFRVGYTITTDKLDAFSKLVKPKGVTMTALLAKAVAVTLARHPQVNAATTAAGMTYPA
EVNVAIAVAMEDGGLITPVLRNADRTDLYEMSRQWKDLVKRSRSKQLQPEEYSTGTFTLS
NLGMFGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIYGAD
GAAFLKDLAELIEHRPESLAL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacccacgacatcttcatgcctgccctcagctccaccatgactgagggcaagatc
gtggaatggctgaagcaaccgggcgacaaggtcggtcggggtgagtctgtgcttgtcgtc
gagtccgacaaggccgacatggacgttgagtccttccaggatggctatctcgctgcagtg
ctgatgccggccggcagtacagcgcccgttggtgaaaccatcggcctgatcgtggagacc
gaggcggagatcgctgacgcccaggccaaggccaccagtgctgcgcccgccgcctcagcc
cctgcccccacaccggcccccgcagctgtgcaggctccggccccgacaccagctccgact
caggccccagcagctccggcaccggtggctgcctcagcagcgccggtggcgaacggacgg
gtggtggccagtcctcgggccaagaagttggcctcccagatgggcgtggacctcagcacc
gtgcgcggcagcggcccccacggccgcattcaggctgaggacgtggaacaagctggtggt
cagcccatctctgtgccccgggttgctgagggcactgcagctgctgttgccgccagcgca
gccccgtcggcggcggcccccagtgcgccggcgggcaacagcttcgggcgtcccggcgac
accgtcgccttcaacaccctccagggtgcggtgaaccggaacatggaggccagcctcgct
gtgccgtgtttccgtgtcggatacaccatcaccaccgacaagctggatgcgttctccaag
ctggtgaaacccaagggcgtcacgatgacggcgctgctggccaaggccgttgccgtcacc
ctggctcgccatccccaggtgaatgccgccaccaccgcggcaggcatgacctatcccgct
gaagtgaacgtggccattgctgtggcgatggaagacggcggcttgatcaccccggtgctg
cgcaatgccgaccgcacggatctctacgagatgtcgcgccagtggaaagatctggtgaag
cggtcccgcagcaagcagcttcagcctgaggaatacagcaccggaaccttcaccctctcg
aacctgggaatgttcggtgtggaccgcttcgatgcgattcttccccccggtaccggagcg
atcctggcggtggcagcctcccgccccacggttgtggcgggcaaggatggttccatcgcc
gtgaaacggcagatgcaggtgaacctcaccgctgatcaccgggtgatttacggcgctgat
ggtgcggcattcctcaaggatctggcggagttgatcgaacatcgccccgagagcctggcg
ctctga

DBGET integrated database retrieval system