KEGG   Synechococcus sp. WH8102: SYNW0698Help
Entry
SYNW0698          CDS       T00144                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00900  Terpenoid backbone biosynthesis
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYNW0698 (dxr)
Enzymes [BR:syw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SYNW0698 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CAE07213
JGI: SYNW0698
CyanoBase: SYNW0698
CYORF: SYNW0698
UniProt: Q7U8C3
Position
complement(681001..682230)
Genome map
AA seq 409 aa AA seqDB search
MLGSTGSIGTQTLQIAEEFPEQFRVVALTAGQNLDLLVQQIQRHQPELVALANADLLPEL
QQRLDALGTDRKRPQLVGGPDGLNIAASWESADLVVTGIVGCAGLLPTLAAVRAGKDLAL
ANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWAENARLSTGVPTPGLRR
IQLTASGGAFRDWKAEDLENATVADATSHPNWSMGRKITVDSASLMNKGLEVIEAHYLFG
LDYDHIEIVIHPQSIIHSMIELADSSVLAQLGWPDMKLPILYCLSWPSRLETPWRRLDLT
EVGQLSFRAPDPAKYPCMQLAYAAGRAGGTMPAVMNAANEEAVAQFLEEKIHFLDIPVVI
EAACERHKADLIAHPQLEDVLAVDQWARMAVREQVKRGTTRVPLAALAA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggctccacgggctcgatcggtacccagacccttcagatcgccgaggaattccct
gagcagttccgcgttgtagccctgacggcagggcagaaccttgatctactggtgcagcaa
atccaacgtcaccagcccgagctggtggctctggccaatgctgatcttctgccggagctg
cagcagcggctcgacgccctcggcacggatcgaaagcgtccgcaacttgtgggcggtccc
gatggcctgaacattgcagcctcgtgggagagcgcggatctggtcgtcaccgggattgtg
ggctgtgcaggcctgctgccgaccctcgccgctgttcgcgctggcaaggacctggccctg
gccaacaaggaaacgctgatcgcagcgggaccggtggtgctgccggaactgaagaaaagc
ggcagccggctgctgcccgcggactcggagcactccgccatttttcagtgcctgcaaggc
actccctgggccgagaacgcccgactctcgacaggagttcccacccctggtctgcgtcgc
attcagctcaccgcctcgggtggagcattccgggattggaaagccgaagaccttgaaaac
gccaccgtggccgatgccaccagccaccccaactggagcatgggacgcaagatcacggtg
gattcagcctcgctgatgaacaaagggctggaagtgatcgaagcccactatctgttcggc
ctggattacgaccacatcgagatcgtgattcaccctcagagcatcatccactcgatgatc
gaactggctgattcctccgttctggcccaattgggatggccagacatgaaattaccgatc
ctttattgcctgagctggccttccaggctggaaacaccatggcgccggttggatctcacg
gaggtgggacaactcagcttccgtgcgcccgatcccgccaagtacccctgcatgcaactg
gcctacgcagcagggagagccggcggcacgatgccggccgtcatgaatgccgccaatgag
gaggcggtcgctcaattcctcgaggaaaaaatccacttcctcgacatccctgtggtgatc
gaggcggcatgcgagcgccataaggctgatctgattgcccacccccagctcgaggacgtg
ctggctgtggatcaatgggcccgcatggccgtgcgggaacaggtgaagcgcggcaccact
cgggtcccgttggcagcgctggcggcatga

DBGET integrated database retrieval system