KEGG   Synechococcus sp. WH8102: SYNW0723Help
Entry
SYNW0723          CDS       T00144                                 

Gene name
hisH
Definition
glutamine amidotransferase class-I
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
syw  Synechococcus sp. WH8102
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syw01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:syw00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(705732..706370)
Genome map
AA seq 212 aa AA seqDB search
MGLHLGLIDYGMGNLHSVEKAFNRLGHQPSRVVNPSDLDGCDALVLPGVGSFDPAIDNLQ
STGLIPDLKRWNEADRPLLGICLGLQLLFESSAEGRLEGLGLIKGHVERLPIGAGARIPH
MGWAPLDLRRANPMLAAADPLAWVYFVHSYAAVPERPETLAAAASFGSSSVTAMVWQRRL
GACQFHPEKSSDSGSAMLKRWLDWLQRGAPIG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttggggcttcatctcggtctgattgattacggcatgggcaatctccactcggtggagaag
gccttcaaccgcctgggtcatcaacccagtcgcgtcgtcaaccccagcgatctcgatggt
tgcgatgctttggttctgcctggcgtcggatccttcgatccagccatcgacaatcttcaa
tccaccggtctgatccccgatctgaaacgctggaatgaggccgaccggcccttgctcggc
atttgtcttggactccaattgctgttcgagtccagtgccgagggccgtcttgagggtctc
ggactgatcaaaggccacgtggaacgtttgcccatcggggctggagcccggattccgcac
atgggatgggcacctctggacctgaggcgagccaacccaatgctcgcggctgcggaccct
ttggcttgggtttacttcgttcacagttatgccgctgtgccggagcgacccgaaacactg
gctgcagcagcatcctttgggagctcctccgtcaccgcaatggtgtggcagcgccgattg
ggcgcttgccagttccacccggaaaaatcatcagacagcggtagcgcgatgctgaagcgt
tggctggattggctccaacgtggagccccgatcggttga

DBGET integrated database retrieval system