KEGG   Synechococcus sp. WH8102: SYNW0784Help
Entry
SYNW0784          CDS       T00144                                 

Gene name
leuB
Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00290  Valine, leucine and isoleucine biosynthesis
syw00660  C5-Branched dibasic acid metabolism
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01210  2-Oxocarboxylic acid metabolism
syw01230  Biosynthesis of amino acids
Module
syw_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    SYNW0784 (leuB)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SYNW0784 (leuB)
Enzymes [BR:syw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     SYNW0784 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CAE07299
JGI: SYNW0784
CyanoBase: SYNW0784
CYORF: SYNW0784
UniProt: Q7U840
Position
764309..765382
Genome map
AA seq 357 aa AA seqDB search
MAQHRVVLLPGDGIGPEITAVARQLLEAVSQRHGFELCFDGQLIGGSAIDACGEPLPAST
LDACKAADAVLLAAIGSPRFDNLPRDKRPETGLLGLRSGMALFANLRPVKIVPALIGASS
LRPEVIEGVDLMVVRELTGGIYFGQPKGRIQADGEERGFNTMTYSSSEVDRIARVAFDLA
RERRGNLCSVDKANVLDVSQLWRDRVDAMAPAYSDVEVSHMYVDNAAMQLVRSPRQFDVL
LTGNLFGDILSDEAAMLTGSIGMLPSASLGSDCPGLFEPVHGSAPDIAGQDKANPMAMVL
SAAMMLRIGLKQTEAAADLEAAVDKVLAAGFRTGDLMAEGCTALGCRAMGDALLKAL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcaccgcgtcgtcctgcttcctggagatggcattggcccggagatcacggct
gtggcgcgccagttgctcgaggcggtgagccagcggcatggttttgaactgtgttttgac
gggcagttgatcggtggcagtgccattgatgcctgcggtgagcccctgcccgccagcacg
ctcgacgcctgcaaggctgctgatgcggttttgctggccgccatcggcagcccccgcttc
gacaaccttccccgcgacaaacgaccggaaaccggtttgctcgggctgaggtcaggcatg
gctctgttcgccaacctgcgccctgtgaagatcgttccggcgctcatcggtgccagcagc
ctgcgtccggaggtgatcgagggtgtggacctgatggtggtgcgagaactcaccggcggg
atctacttcgggcagcccaagggacggatccaggccgacggagaggagcgtggcttcaac
acgatgacctactcctctagcgaggtggatcgcatcgccagggtggccttcgacctggcc
cgggaacgtcgcggcaacctctgctccgtggacaaggccaacgtgctggatgtgagccag
ctgtggcgggaccgggtggatgcgatggctcccgcctacagcgatgtggaggtcagccac
atgtatgtggacaacgccgcgatgcagctggtgcgcagtccacgccaattcgacgtgctg
cttacggggaacctgttcggagatatcctcagcgatgaggccgccatgctcaccggctcg
atcggcatgcttccatcggcctcccttggcagcgactgtcctggcctgttcgagccggtg
catggctctgcgccggacatcgccggccaggacaaggccaatccaatggcgatggtgctc
tcggccgcgatgatgctgcgaatcggtcttaagcagacggaggctgccgctgatctcgag
gcggctgtggacaaggtgttggcggctggcttccgcaccggagatctgatggcagagggc
tgcaccgcgctgggatgccgtgccatgggcgacgcattgttgaaggctctctga

DBGET integrated database retrieval system