KEGG   Synechococcus sp. WH8102: SYNW0820Help
Entry
SYNW0820          CDS       T00144                                 

Gene name
chlH
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
788971..792981
Genome map
AA seq 1336 aa AA seqDB search
MFTQVRSADRRVAPVEGQSHKSVMKAVYVVLEPQYQNALTQAATALNASGSELGIELSGY
LIEELRDEENYAGFCEDVAQADVFVASLIFIEDLAQKVVDAVAPHRDRLKAAVVFPSMPE
VMRLNKLGSFSMAQLGQSKSAIAGFMKKRKEAGGAGFQDAMLKLLNTLPTVLKYLPVEKA
QDARSFMLSFQYWLGGTPDNLKNFLLMLADKYVFPPAEGEERPAMEVAEPEVFPDLGIWH
PLAPMMFEDLKEYLNWTASRTDLSEEARKGPVIGLVLQRSHIVTGDDAHYVATIQELEFR
GARVIPIFCGGLDFSKPVNAFFYDPLNPEQPLVDGIVSLTGFALVGGPARQDHPKAIESL
KKLNRPYMVALPLVFQTTQEWEDSDLGLHPVQVALQIAIPELDGAIEPIVLSGRDDATGK
AHTLQDRVDAIAERAIRWSSLRIKPRIDKKLAITVFSFPPDKGNVGTAAYLDVFGSIHRV
MEEMKAKGYDVQGLPSTPRALLEAVINDADAMQGAPELSIAHRMSVEEYERLTPYSERLE
ENWGKPPGNLNSDGQNLLVFGRHFGNVFVGVQPTFGYEGDPMRLLYSRSASPHHGFAAYY
TYLQKIWKADAVLHFGTHGSLEFMPGKQMGMSETCYPDSLIGALPNLYYYAANNPSEATI
AKRRGYASTISYLTPPAENAGLYRGLKELGELVGSYQQLREGGRGIQIVNTIIETARQCN
LDKDVDLPEDDASTLELDGRDALVGAVYRQLMEIESRLLPCGLHTIGKPPTAEEAVATLV
NIAALEREEDGLRSLPGLLAEAMGRSIEDIYKGNDYGVLADVELNRTITETSRAAIGAMV
RSLTGLDGRVSMRNSFGWFYDLLAKFGLKLPSPWLRACCGAGFVQIDATELDKLFAYLRF
CLEQVCADMEMESLLKALDGDYILPGPGGDPIRNPGVLPSGKNIHALDPQAIPTRAAVAA
AKSVVDKLIERQREEQGTWPETIACVLWGTDNIKTYGESLAQILWFVGVKPMPDSVGRVN
KLELIPLEELGRPRVDVVVNCSGVFRDLFINQMALIDQAVKMAAEADEPLELNFVRKHAL
EQAEKEGTSLRDAACRVFSNASGSYSSNVNLAVENSTWEEEGELQEMYLSRKTFAFNADN
PGEMNQKREVFENVMKTADVTFQNLDSAEISLTDVSHYFDSDPTKLIAGLRDDGKAPTSY
IADTTTANAQVRSLSETIRLDSRTKLLNPKWYEGMLDSGYEGVREVAKRLNFTLGWSATS
GAVDNFVYEEANDTFINDPEMRKRLLELNPNSFRQIVGTLLEVHGRGYWETSDENIEQLQ
ELYQEVEDRIEGVVTD
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgttcacacaggtccgctccgccgatcgccgcgttgctcctgtagagggacagagccac
aagtccgtgatgaaggcggtttatgtggtgcttgagccccagtaccagaacgcgctgact
caggcggcaacagctctcaatgcgtccggcagtgaacttggaatcgagctgagcggctat
ttgatcgaagagctccgtgacgaggagaactacgccggtttctgtgaggacgtggcacag
gcggatgtgttcgtcgcctcgttgatcttcatcgaagatctggcacagaaggtggtggat
gccgttgcaccccatcgcgaccggctcaaagcggcagttgtgttcccctccatgccggag
gtgatgcgtctgaacaagctcggcagcttttccatggctcagttgggccagagcaagagc
gcgatcgccggtttcatgaaaaagcggaaggaggccggtggtgctggtttccaggacgcc
atgctcaagcttctgaacacgcttccgactgttctcaagtacctgccggttgagaaggcg
caggatgcccgcagtttcatgctcagcttccagtactggctcgggggaacgccagacaac
ctgaagaacttcctgctgatgctggcggacaagtacgtcttccctcctgcagaaggcgag
gagcgtccagcgatggaggttgccgagcctgaagtgttcccggatctggggatctggcac
cccttggctcccatgatgtttgaggacctcaaggagtacctcaactggaccgccagccgc
accgatctctccgaagaagcccgcaaaggtccggtgatcggtttagtgctgcagcgcagc
cacatcgtcaccggtgatgacgcccattacgtggccacaattcaggagctggaattccgc
ggtgcccgcgtgattccgatcttctgcggcggcctggacttctccaagcccgtcaacgcc
ttcttctacgacccgctcaaccctgagcagcctctggtggatggcatcgtttccctgacg
ggctttgcactggtgggtggcccggcccgacaggatcatcccaaggcgatcgagtcgctg
aagaagctcaaccgcccttacatggtggctttgcctcttgtctttcagaccacccaggaa
tgggaagacagcgacctgggtctgcacccagttcaggttgcacttcagatcgccatccct
gagctcgatggtgcgatcgaacccatcgtgctctcaggccgtgatgacgccacaggtaag
gcacacaccctgcaggaccgagtggatgccatcgcagagcgcgccatccgctggtcgtcc
ctgcggatcaagccccgcatcgacaagaagctggcgatcaccgtgttcagcttcccgccg
gacaaaggcaatgtcggcacagcggcttacctcgatgttttcggctccatccatcgggtg
atggaggagatgaaggccaagggctacgacgttcaaggtctgccctccacaccaagagct
ttgctcgaggctgtcatcaacgacgccgatgccatgcagggagcccccgagctctcgatc
gcacaccgtatgagcgtggaggagtacgagcgcctgacgccttactccgaacgactggaa
gagaactggggcaagccccccggcaacctcaacagcgatggccagaacctgctggtgttt
ggtcgccatttcggcaacgtctttgttggcgttcaacccaccttcggctacgaaggcgac
ccaatgcgcctgctctattcccgtagtgcaagcccccaccacggttttgccgcttactac
acctatttgcagaagatctggaaggctgacgcggtgctgcacttcggcactcacggctcc
ctcgagttcatgcccggtaagcagatggggatgagcgaaacctgctatcccgattcactg
atcggtgcactgcccaacctctattactacgccgccaacaacccctccgaggccaccatt
gccaagcggcgtggttatgcctcaaccatcagctacctcacccctccggccgaaaacgca
ggcctctatcgaggtttgaaggaactgggtgagctggtgggctcctaccagcagctgcgc
gaaggtggccgcggcattcagattgtcaacacgatcatcgagacggcacgtcagtgcaat
ctcgataaggacgtcgatcttcctgaggatgatgcttcgacccttgaactagacggacgt
gatgccctggtgggtgccgtttaccgccagttgatggagatcgaaagtcgactgcttcct
tgcggtctgcacaccatcggcaaaccaccaacagctgaagaagctgttgccacccttgtg
aacatcgctgctcttgagcgcgaagaagatggcctgcgctcacttcccggcctgttggct
gaggccatgggtcgttccattgaagacatctacaaaggcaatgactacggtgtgctcgcc
gatgtggagctgaaccgcacgatcacggagacatccagggccgccatcggcgccatggtt
cgctccctgaccggccttgatggtcgcgtcagcatgcgaaacagcttcggttggttctac
gacctgctggcgaagttcggactcaagctcccttctccctggctgcgggcctgttgcggg
gctggttttgtccagattgatgccactgaactcgacaaactgtttgcctatctgcgcttc
tgtttggagcaggtgtgtgccgatatggaaatggagagtctgctcaaggctcttgacggt
gactacatcctcccggggcccggtggtgatccgatccgtaatcctggcgtcctgcccagc
ggcaagaacattcacgccctggacccccaggccattccgaccagggctgctgtcgccgca
gcgaagagtgttgttgacaagttgattgagcgtcagcgcgaggagcagggcacctggccc
gaaacgattgcctgcgtgctctggggcacggacaacatcaagacttacggcgaatccctg
gctcagatcctttggttcgtcggtgtcaagccgatgcctgattccgtgggtcgggtgaac
aagcttgagctgattcccctggaagagctgggtcgcccccgggtggatgtggtggtgaac
tgctccggtgtattccgtgatctgttcatcaaccagatggctttgattgatcaggccgtg
aaaatggcggccgaggcggatgagcccctcgagctgaatttcgtgcgcaagcacgctctg
gagcaggcagagaaagagggcacctcccttcgggatgccgcctgccgcgtgttctccaat
gccagcggcagctacagctccaacgtgaacctggcggtggagaacagcacctgggaggaa
gagggcgagcttcaggagatgtatctctcccgcaagacctttgccttcaatgctgataac
cctggtgagatgaaccagaagcgtgaggtgttcgagaacgtgatgaagacggcggatgtc
accttccagaacctcgactccgcggagatctccctcacggatgtcagtcactactttgac
tccgaccccaccaaactgatcgccggcctgcgggatgacggcaaagctcccaccagctac
atcgctgacaccacgacggccaacgcgcaggttcgttcgctgagtgaaacgattcgcctg
gattcacgcaccaagttgctgaatcccaagtggtacgagggcatgctcgactctggttat
gaaggtgtgcgtgaagtggcaaagcgcctcaacttcacccttggctggagtgccaccagt
ggtgccgtggacaacttcgtgtacgaggaagccaatgacaccttcatcaatgatccggag
atgcgcaaacgcctcctggaactgaatcccaacagcttccgtcagatcgttggaactctg
ctggaggttcatggccgtggctattgggagacgtccgatgagaacatcgaacaactccag
gagctgtaccaagaggttgaggatcgcattgaaggcgtcgttactgactga

DBGET integrated database retrieval system