KEGG   Synechococcus sp. WH8102: SYNW0822Help
Entry
SYNW0822          CDS       T00144                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syw  Synechococcus sp. WH8102
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNW0822 (folP)
Enzymes [BR:syw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SYNW0822 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(793966..794874)
Genome map
AA seq 302 aa AA seqDB search
MISTASWSVVHRSNPTVSPGLPTTRPFDVSHHWPEGWLQRTAVMGVINITPDSFSDGGRF
IKVEAAVQEAKRQLQQGADVLDLGAQSTRPGAIEVGAEEECRRLLPVLAAVRKQWPEVVI
SVDTFLAPVATAALEAGASWINDVSGGRRDPELLRVVADAGCPVVLMHSRGNSQTMDDLT
DYSDLIQEVKSGLLERTDSAVTAGVREDQIIWDPGLGFAKTHEQNLKLLKDLEQLTCGPR
PLLIGPSRKRFIGAVLDEPRPKARLWGTAAVACRCAQAGVALVRVHDVGPIAQTLRMASA
LW
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgatatcgacggcgtcttggtcggtggtgcatcgctcaaacccgacagtttcgcccgga
ttgccaactaccaggccatttgatgtgagtcaccactggcctgaaggctggctgcaacgc
accgccgtgatgggggtgatcaacatcacaccagactccttcagtgatggcggtcgtttc
atcaaggttgaggcggcagtccaggaagcgaaacggcaattgcaacaaggggctgatgtc
ctggatctcggggcccagagcactcgtcccggtgccatagaggtgggtgctgaggaggaa
tgccgacgcttgctgccggtgcttgccgccgtgcgcaagcaatggcctgaggtggtgatc
tcggtggacaccttcctggcacccgtggcgacggcagcgctggaagccggcgccagctgg
atcaacgatgtgagcggaggccggagggatccagagctgctgcgggtggtggccgatgcc
ggctgcccggtggtgctgatgcacagccgcggcaacagtcaaacgatggacgacctcacc
gactacagcgatctgattcaggaggtgaagagtggactcctggaacggacggattcggcg
gtcaccgctggggtcagggaggatcagatcatctgggatcccggcctcggcttcgccaaa
acccatgagcagaatctgaaattgctgaaggatcttgagcagctcacctgtggacccaga
ccacttctcattggaccgtcacgcaaacgattcatcggagcggtattggatgaacccaga
cctaaggcgcgcctatggggaacagcggcggtggcctgtcgttgcgcccaggccggtgtt
gcactggtgagggttcacgacgttggtccgatcgcgcagactttgcgaatggcgtcagcc
ctctggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system