KEGG   Synechococcus sp. WH8102: SYNW0823Help
Entry
SYNW0823          CDS       T00144                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:syw01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:syw01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syw00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:syw00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:syw00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:syw00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(794792..795523)
Genome map
AA seq 243 aa AA seqDB search
MRRPVIAGNWKMHMTCAQARDYMAAFLPQIERAPQDREIVLAPPFTALSTMAAAAEHSVV
GLASQNVHWQDHGAFTAEISAEMLLEHGVAYTIVGHSEPRKYFSESDEQINHRARCSQAK
GLIPIVCVGESDEQRERGEAERVIRRQIEQGLEGLDANKLVVAYEPIWAIGTGKTCEAAE
ANRICGLIRSWVGATDLIIQYGGSVKPTNIDELMAMSDIDGVLVGGASLKPDSFARIANY
QAI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtagaccggtgattgctggcaactggaagatgcacatgacctgtgcccaggccagg
gattacatggcagcattccttccgcaaattgaacgtgccccccaggaccgcgagatcgtc
ctggctccgcccttcactgcgctctccaccatggcggcagcagctgaacactccgttgtg
ggactcgccagtcagaacgtccattggcaggaccatggtgcattcacagccgaaatttcg
gccgagatgctgttagagcacggcgttgcatacacaatcgttgggcacagcgagccccgc
aaatacttcagcgaaagtgatgagcagatcaaccacagggcccgctgctcccaggccaag
gggttgatccccatcgtctgtgttggagaaagtgatgagcagcgcgaacggggtgaagcg
gagcgggtgatccgccgacagatcgagcagggacttgaagggttggacgccaacaaactt
gttgtggcctatgaaccgatctgggccatcggcacgggtaaaacctgcgaagcagccgaa
gccaacaggatctgcggactgatccgaagctgggtgggagccaccgatctgatcattcag
tacggcggatccgtgaagcccaccaacatcgatgaactcatggccatgagtgatatcgac
ggcgtcttggtcggtggtgcatcgctcaaacccgacagtttcgcccggattgccaactac
caggccatttga

DBGET integrated database retrieval system