KEGG   Synechococcus sp. WH8102: SYNW0823Help
Entry
SYNW0823          CDS       T00144                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNW0823 (tpiA)
   01230 Biosynthesis of amino acids
    SYNW0823 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNW0823 (tpiA)
   00051 Fructose and mannose metabolism
    SYNW0823 (tpiA)
   00562 Inositol phosphate metabolism
    SYNW0823 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNW0823 (tpiA)
Enzymes [BR:syw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SYNW0823 (tpiA)
Exosome [BR:syw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SYNW0823 (tpiA)
  Exosomal proteins of bladder cancer cells
   SYNW0823 (tpiA)
  Exosomal proteins of melanoma cells
   SYNW0823 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(794792..795523)
Genome map
AA seq 243 aa AA seqDB search
MRRPVIAGNWKMHMTCAQARDYMAAFLPQIERAPQDREIVLAPPFTALSTMAAAAEHSVV
GLASQNVHWQDHGAFTAEISAEMLLEHGVAYTIVGHSEPRKYFSESDEQINHRARCSQAK
GLIPIVCVGESDEQRERGEAERVIRRQIEQGLEGLDANKLVVAYEPIWAIGTGKTCEAAE
ANRICGLIRSWVGATDLIIQYGGSVKPTNIDELMAMSDIDGVLVGGASLKPDSFARIANY
QAI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtagaccggtgattgctggcaactggaagatgcacatgacctgtgcccaggccagg
gattacatggcagcattccttccgcaaattgaacgtgccccccaggaccgcgagatcgtc
ctggctccgcccttcactgcgctctccaccatggcggcagcagctgaacactccgttgtg
ggactcgccagtcagaacgtccattggcaggaccatggtgcattcacagccgaaatttcg
gccgagatgctgttagagcacggcgttgcatacacaatcgttgggcacagcgagccccgc
aaatacttcagcgaaagtgatgagcagatcaaccacagggcccgctgctcccaggccaag
gggttgatccccatcgtctgtgttggagaaagtgatgagcagcgcgaacggggtgaagcg
gagcgggtgatccgccgacagatcgagcagggacttgaagggttggacgccaacaaactt
gttgtggcctatgaaccgatctgggccatcggcacgggtaaaacctgcgaagcagccgaa
gccaacaggatctgcggactgatccgaagctgggtgggagccaccgatctgatcattcag
tacggcggatccgtgaagcccaccaacatcgatgaactcatggccatgagtgatatcgac
ggcgtcttggtcggtggtgcatcgctcaaacccgacagtttcgcccggattgccaactac
caggccatttga

DBGET integrated database retrieval system