KEGG   Synechococcus sp. WH8102: SYNW0918Help
Entry
SYNW0918          CDS       T00144                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
syw  Synechococcus sp. WH8102
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
878771..880324
Genome map
AA seq 517 aa AA seqDB search
MSSSWSPAFATAVHAALVRRCPPAEGGAALAELSQALVDALERGELDLPLTPDRAAVVQA
SGWLEGDDSPLLQRGERIGWRRWLEAMEGVVEQLLERQPPSLPTPQEAPELPSTLNPEQQ
AAVLAMDGAAVVLLSGGPGTGKTSTVVELLRRASQRHPTLRIGLAAPTGKAARRLGDAVR
PGLNELPCFTLHRWLEAAGDGFRRHRQRPLELDLLVVDEMSMVDLELMSALLEALPDACR
LLLVGDPAQLPPVGSGAVWQRLQDPAVRERFGSAAVHLLHTYRNRGALAALATTLRQQGI
EAFRRDLEQLPATANVQHQRASLRRLPPSVRDGWRDRHQRLSALATGLVEMPESELNDAA
GQLLLELENDLVLCPRRRGPWSLEDVHRSLLGGGGWMEPLHWPEGVPVICGSNQPEVGLA
NGDLGVKLGSGEQSRVLFRVMAADGQPQIRRLHPARLTSLEPALALTIHRAQGSEADRVT
VLWPPLQEDNIAYDSCLLYTAITRARGSLDLITAVDR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagctggtctccggcctttgccacagcggttcacgctgccctggtgcgccgc
tgtccgccggctgaagggggagctgctctggctgagctcagccaggccctggtggatgcg
ctggagcggggtgagctggatctgccgctcacgccggaccgggctgcggtggttcaagcc
agtggctggttggagggggacgactcgccgctgctgcaacggggcgagcggatcggctgg
cggcgctggctggaagccatggagggggtggtggagcagctgctggagcgacagccgcca
tccctgcctacccctcaggaggccccagagctcccgagcacgctcaatcccgagcaacag
gctgcggtgttggccatggatggtgccgccgtggtgctgctcagcggtggcccgggcacg
ggcaagaccagcacggtggtggagctgttgcggcgggcgagccagcgccatcccacattg
cgtattgggctggcggcacccaccggtaaagcagcgcgtcggttgggggatgcggtgcgg
cctgggttgaacgagctgccctgtttcaccctgcatcgctggctggaggccgccggggat
gggttccgtcgccatcgtcagcgaccgctggagcttgatctgctggtggttgatgagatg
tcgatggtggatctggagttgatgagcgccctgctggaggcgttgccggatgcgtgccgg
ctgttgttggtcggtgacccggcgcagttgcctccggtggggagtggtgcggtctggcaa
cggttgcaggatcccgccgtgcgtgagcgctttggttctgcagcagttcatctgttgcac
acctaccgcaaccgcggtgctctggcggcgttggccacgaccctgcgtcagcaggggatc
gaagcgttcaggcgggatctggagcagctgccggcaacggccaacgttcagcaccagcgg
gccagtctgcggcggctgccgccatcggtgcgggatggctggcgggatcgccatcagcgc
ctctcagccctggcgacggggttggtggagatgccggagtctgagctgaacgacgcagcg
ggtcagttgctgctggaactggagaacgatttggtgctctgccctcgccggcgtggaccc
tggagccttgaggacgtgcaccgatcgcttttgggtggagggggctggatggaaccgttg
cactggccggagggggtaccggtgatctgtggtagcaatcagccggaggtggggctcgcc
aatggtgatctcggcgtcaagctgggatccggcgagcagagtcgggtgctgttccgcgtg
atggcagcggatgggcagccgcagatccgccggctgcatccagctcggttgacgtccctg
gagccggctctggcgctcaccattcatcgggcccagggcagcgaggctgaccgggtcacc
gtgctgtggccaccgctgcaggaggacaacatcgcgtacgacagctgtcttctgtacaca
gccatcacgcgggcccgtggcagcctggatctgattactgctgtcgatcgctga

DBGET integrated database retrieval system