KEGG   Synechococcus sp. WH8102: SYNW0928Help
Entry
SYNW0928          CDS       T00144                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
syw  Synechococcus sp. WH8102
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYNW0928 (recR)
DNA repair and recombination proteins [BR:syw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SYNW0928 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
889099..889677
Genome map
AA seq 192 aa AA seqDB search
MARLIDQFERLPGIGPRTAQRLALHLLNQPEEQIRQFADALLAARTQVGQCQTCFHLSAD
PECEICRNPERRNGLICVVADSRDLLALERTREFQGRYHVLGGLISPMDGIGPELLHVTP
LVARINQEDITEVILALTPSVEGDTTSLYLARLLKPFCPVSRIAYGLPMGSELEYADEVT
LSRALEGRRPLD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggcccggctgatcgatcagtttgagaggctcccagggattggcccgcgcacggcgcaa
cggcttgctttgcatctgctgaaccagccagaggagcagatccgccagtttgctgatgcc
ctgctggcggcccgcacacaagtggggcaatgccagacctgctttcatctgtcggccgat
ccggaatgcgagatctgccgcaacccggagcgccgcaacggtttgatctgtgtggtggcc
gattcccgagacctgctggccctggagcgcacacgagagttccaaggccggtatcacgtt
cttggtggtttgatctcgccgatggatggcatcggcccggaattgctccatgtgaccccg
ctggtggccaggatcaatcaggaggacatcactgaggtgatcctggcactgactcccagc
gtggagggggacaccaccagcctttatctggctcgtttgctcaagccgttttgtcccgtg
agccgcatcgcctatggcctgccgatggggagtgaactggagtacgccgacgaggtcact
ctcagccgggccctggagggccggcgcccgctggactga

DBGET integrated database retrieval system