KEGG   Synechococcus sp. WH8102: SYNW0962Help
Entry
SYNW0962          CDS       T00144                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syw  Synechococcus sp. WH8102
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SYNW0962 (malQ)
Enzymes [BR:syw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SYNW0962 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(955321..956859)
Genome map
AA seq 512 aa AA seqDB search
MTTPSRSTGVLLHPTALPGSAVCGSFGEPCRRWINLLADNNIGVWQLLPLAPPDGTGSPY
NSPSSFALNPWFLDAEELRRDGFISEQDCQDLPGASEPSSGVERLDFGLAQQRSGALAQT
LLKGWPKQPTNHHQTFERWCKKQPWLEAHACFSVLHEQQGEAWWTWPDGLASNNRKALRE
WKRDHADALLAIKLQQWHLDQQWNAIRELAREKGVILFGDLPFYVSADSADVWSNRHLFT
IKENGELTTQSGVPPDYFSESGQLWGSPVYRWGRHRLTRYRWWRQRFTRQRQLADLLRLD
HFRALAAYWAVPGADKTAKNGQWQPSPGNELLKKLRQDGNGELPLIAEDLGVITPDVEEL
RDNFKLRGMKVLQFAFDGQADNPYLPENIEGRRWVVYTGTHDNPTTLGWWNTLDQDSRNR
ITCRINGAVNAPAWQLLDMAFATSAELVVAPLQDLLHLDDSARFNTPGTSTGNWNWRQPN
FDKNVEGALQGFGERGSIWGRSKNGAKHMTKN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacgactccatcccgaagcacaggggtgcttctacatcccacagcacttcctgggagt
gcagtctgcggaagcttcggagaaccatgccgccgttggatcaatctgctggcggacaac
aacatcggcgtgtggcaacttctgccacttgcacctcctgacggaaccggctcgccttac
aactcaccctccagcttcgcgctgaatccctggtttcttgatgccgaggaacttcgccgg
gatggcttcatcagtgagcaggattgccaagacttacctggagcgagtgaaccaagcagt
ggcgtcgagagattggactttggcctggcccaacagcgaagcggcgcccttgcccaaaca
ctgctcaaaggatggccgaagcagccgaccaatcatcaccagacgtttgaacgttggtgc
aaaaaacagccgtggctggaagctcacgcctgcttcagcgttctgcatgaacagcagggt
gaagcctggtggacctggcctgatgggcttgcaagtaacaaccgcaaggcgctgcgtgaa
tggaaacgtgatcatgccgatgcactgctggccatcaagctgcagcaatggcacttggat
caacagtggaatgcaatcagggagctagcacgagagaaaggcgtcatactgttcggagat
ctgccgttctatgtcagtgcagacagcgctgatgtctggagcaatcgtcacttattcacc
atcaaggagaacggtgaactcacaacccaaagtggcgtacctcctgactacttctccgaa
agcggacagctctggggttcaccggtttatcgctggggacgacatcgcttaacgcgctat
agatggtggagacagcgattcacacgacaacgccagctagcggacctgttgcgactcgat
cactttcgagcactagctgcctactgggcagtccccggagcagacaagacagctaaaaac
ggacagtggcagccgtctccgggaaacgagctgctgaagaagcttcgtcaagatggcaat
ggagaattacctttaattgctgaagacctaggggtcatcacacccgatgtagaggagcta
cgcgataactttaaattgcgagggatgaaagtgcttcaatttgccttcgatggacaggcc
gacaacccatacctgcctgaaaatatcgagggacgacgttgggtggtctacaccggcacc
cacgacaacccgactacactgggctggtggaacacacttgatcaggacagccgcaaccga
atcacatgtcgaatcaatggagcagtgaacgcaccggcttggcagttgctcgacatggca
tttgcaacatcggcagaactggtcgtcgccccactgcaggatctgcttcacttagatgat
tcagctcgtttcaacacaccagggacatccacaggaaattggaactggcgtcaaccgaac
tttgataaaaacgtggaaggtgcacttcagggttttggagaaagaggatcgatctgggga
cgctccaaaaatggagccaagcacatgacaaaaaattag

DBGET integrated database retrieval system