KEGG   Synechococcus sp. WH8102: SYNW1013Help
Entry
SYNW1013          CDS       T00144                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00010  Glycolysis / Gluconeogenesis
syw00620  Pyruvate metabolism
syw00640  Propanoate metabolism
syw00680  Methane metabolism
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01120  Microbial metabolism in diverse environments
syw01130  Biosynthesis of antibiotics
syw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNW1013 (acs)
   00620 Pyruvate metabolism
    SYNW1013 (acs)
   00640 Propanoate metabolism
    SYNW1013 (acs)
  Energy metabolism
   00680 Methane metabolism
    SYNW1013 (acs)
Enzymes [BR:syw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SYNW1013 (acs)
Lipid biosynthesis proteins [BR:syw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SYNW1013 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAE07528
JGI: SYNW1013
CyanoBase: SYNW1013
CYORF: SYNW1013
UniProt: Q7U7H1
Position
1011284..1013353
Genome map
AA seq 689 aa AA seqDB search
MVSPSVRRIDTGRGTVDRLLRTLATTVFGPPAVTESNTSIESVLQEQRVFQPPAEMAAAA
RIGSLESYRAMAAAATKDPDGFWGEAARRELHWFEPFHTVLDWSEPPFARWFEGGTTNLS
YNCLDRHLEGAKAEKTALIWEGEPGDVRRFSYRELHAEVCKAANALKAMGIGKGDLVALY
MPMIPEAAIAMLACARIGAPHSVVFGGFSAEALRDRLKDGEAKAVITADGGFRKDKPVSL
KPAVDAALAEGACPSVTGVLVVQRTKQPVEMVAGRDQWWHDLVDAQGSDCPAEPMASEDR
LFVLYTSGSTGKPKGVVHTTAGYNLWAHLTFQWIFDIRDNDVYWCTADVGWITGHSYIVY
GPLSNGATTVMYEGAPRPSKPGAFWELIQKHGITIFYTAPTAIRAFMKSGRQVPDQFDMS
SLRLLGTVGEPINPEAWMWYRDVIGGNRCPIVDTWWQTETGGVMISPLPGATPTKPGSAT
LPLPGIQADIVDGEGNSCGPDEGGYLAVRAPWPGMMRTVHGNPQRFRESYWEHIRPADGS
YLYFAGDGARRDADGYFWVMGRVDDVINVSGHRLGTMEIESALVSHPAVAEAAVVGRPDD
LKGEGIVAFVTLESGRESSDDLIKQLRAHVGTEIGPIARPDEIRCSDALPKTRSGKIMRR
ILRALAAGQEVSGDTSTLEDRSVLDRLRA
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
gtggtttcaccctctgtccgacggattgatacgggtcgtggaacggtcgatcgactcctc
cgtacccttgcaacaacagtctttggcccgcctgctgtgaccgagtccaatacgtcgatc
gaaagtgtcctgcaggagcagcgggtatttcagccgccggcggagatggcggctgcagca
cgcatcggcagtctggagagttaccgcgccatggcggcggcggcgaccaaggatcccgat
gggttctggggggaggcagcccgtcgtgagctgcattggttcgagccgttccacacggtt
ctcgattggtcggaacctcctttcgcccgctggtttgaagggggcaccaccaacctgtcg
tacaactgtctcgaccgacatctcgagggggccaaggccgagaagaccgcgctgatctgg
gaaggggagcccggagacgtgcgccgtttcagctaccgcgagctccatgccgaggtgtgc
aaagccgccaacgctctgaaggccatgggcattggcaaaggcgatctggtcgccctctac
atgccgatgattccagaggccgccattgcgatgctcgcctgcgctcgcatcggtgccccc
cattccgttgtgttcggtggtttctctgccgaggccttgcgcgatcgcctcaaggacggt
gaggcgaaggccgtgatcacagcggatgggggattcagaaaggacaagcccgtttccctc
aaacctgctgttgatgcagctctagcggagggcgcctgtccttcggtgaccggcgtgctc
gtggtgcagcgcaccaagcagcccgtggagatggttgccggccgcgatcagtggtggcac
gacctcgtggatgcccagggcagcgattgccctgcggagccgatggccagtgaagatcga
ctgttcgtgctctacacctcaggttccaccggcaaacccaagggtgtagtgcacaccact
gccggttacaacctctgggcccatctcaccttccagtggattttcgacatccgcgataac
gacgtctactggtgcacagcggatgttggctggatcactggccacagctacatcgtgtac
ggcccgctgtccaacggtgcgaccaccgtgatgtacgagggggcgccgcgcccctccaaa
cccggtgcgttctgggagttgatccagaagcacggcatcacgatcttttacaccgcgccg
actgcgattcgagccttcatgaagagtggccgccaggtgccggatcaattcgacatgagc
agccttcgcctgctgggcaccgttggtgaaccgatcaatccggaggcctggatgtggtac
cgcgacgtgattggcggcaaccgctgtccgattgtcgacacttggtggcagaccgaaacc
ggtggcgtgatgatcagtccgctgcctggagccactcccaccaaaccgggatccgccacg
ctgccgctgccgggcattcaggccgacatcgttgatggagaaggcaacagctgcgggccc
gatgaaggtggatacctggctgtccgagccccctggcctggaatgatgcgcacggtccat
ggcaacccccagcgctttcgtgagagctattgggagcacatccgtcctgccgatggctcg
tacctctatttcgctggggatggcgcccgccgtgatgccgatggatatttctgggtgatg
ggccgggtggatgacgtgatcaacgtctccggtcaccgcctcggcacgatggaaattgag
tcggctctggtgagccatcccgcggtggcggaagctgctgtggtgggtcgtcccgatgac
ctcaaaggtgaaggcatcgttgcgttcgtcacccttgagtcggggcgtgagtcgtcggat
gatctgatcaagcaactcagggcccatgtgggcacggagataggaccgatcgctcggccg
gatgagattcgttgcagtgatgcactgcccaagacccgcagcggcaagatcatgcgccgg
atcctgagggccctggccgccggtcaggaggtcagcggcgacaccagcaccctggaggat
cgttcggtcctcgatcggctgcgggcttga

DBGET integrated database retrieval system