KEGG   Synechococcus sp. WH8102: SYNW1480Help
Entry
SYNW1480          CDS       T00144                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNW1480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNW1480
   00052 Galactose metabolism
    SYNW1480
   00500 Starch and sucrose metabolism
    SYNW1480
   00520 Amino sugar and nucleotide sugar metabolism
    SYNW1480
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNW1480
   00524 Butirosin and neomycin biosynthesis
    SYNW1480
Enzymes [BR:syw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNW1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1429856..1430890
Genome map
AA seq 344 aa AA seqDB search
MPRPTLLAGDMGGTKTLLALYDLEGETLIKRHQQRFVSADWSSLEPMLQAFVEERPKDVQ
APTHGCIAVAGPVRNRQARITNLPWQLKEEDLAAAAGMQQLELVNDFGVLIYGLPHFGAD
QQVVLQEGSQDDGPLAILGAGTGLGMARGVRTSNGLMALSSEGGHREFAPRSDEEWQLAC
WLKQDLGVDRLSIERVVSGTGLGHIAHWLLQQPGAQSHPLRPVAEAWRRNMASDLPAQVS
LAAEEGDPLMRHALDLWLSAYGSATGDLALQELCSGGLWVGGGTASKQRNGLQSPLFLEA
MRDKGRFKDFISGLKVTAVIDPEAGLFSSACRARMLAESGGTLA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtcccactcttctcgctggcgacatgggggggaccaagacccttcttgcgctc
tacgacctcgagggtgaaacgctgatcaaacgtcaccagcaacggtttgtctcagctgat
tggtcatcgctggagccgatgcttcaggcgtttgttgaggaacggcccaaggacgtccag
gcgccaacccatggctgcatcgccgtggcaggccctgttcgcaatcggcaggcccggatc
accaacctcccctggcagctcaaggaagaggatctggctgccgccgcagggatgcagcaa
ctggagctggtgaacgatttcggtgtgctgatctacggcctgcctcacttcggcgcggat
cagcaggtggtgctgcaggaggggagtcaggacgacgggcccctggccatccttggagct
gggaccggcctcggcatggctcgaggcgttcgcaccagcaacgggctgatggctctctcc
agcgagggtggacatcgcgaattcgcaccgcgcagcgatgaggaatggcaactggcctgc
tggctcaaacaggacctgggagtcgaccgcctgtcgatcgagcgggtggtgagcggcaca
gggcttggccacatcgcccattggctgctgcagcagccaggcgcacaatcccaccccctt
cgtcctgtggctgaggcctggcggcgaaatatggccagtgaccttccagctcaggtgtct
ctcgcggccgaagagggggaccctctgatgcgacatgcccttgacctgtggctgtcggcc
tacggctcagccacaggtgacctggccctgcaggaactctgcagcggtggtctctgggtg
ggaggcggcacggcctcaaaacaacgcaacggactgcaatccccgctgttccttgaggca
atgcgcgacaaaggtcggttcaaggacttcatcagcggtctgaaggtcaccgctgtgatc
gatccggaggctggtctgttcagctctgcctgccgagcacggatgttggcggagtcgggt
gggacactggcctga

DBGET integrated database retrieval system