KEGG   Synechococcus sp. WH8102: SYNW1487Help
Entry
SYNW1487          CDS       T00144                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNW1487
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNW1487
   00052 Galactose metabolism
    SYNW1487
   00500 Starch and sucrose metabolism
    SYNW1487
   00520 Amino sugar and nucleotide sugar metabolism
    SYNW1487
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNW1487
   00524 Butirosin and neomycin biosynthesis
    SYNW1487
Enzymes [BR:syw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNW1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1437863..1438771)
Genome map
AA seq 302 aa AA seqDB search
MDDGQAIGIDLGGTAIKLARFDPRGALLAELEVATPQPAVPGAVTMALCDAVEELDPDGA
AALVGVGLPGPMDATARVARVCINLPGWEDVPLAEWLEVRLQRRVTLANDGNCAVVGEAW
WGAAKGFSDVVLLTLGTGVGGGVLLGGQLFTGHNGAAAEPGLIGVDPDGPACNSGNRGSL
EQFASIAALRRLCDRDPRELSLAAEEGEPAALEVWERYGTRLGVGLSSLVYVFTPQLVLL
GGGLAGAARHFLPAVRREVELRVQAVSREGLRIDACALGNGAGRLGAARLALLRLGGMMA
DD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgggcaggcgatcggcattgatctcggcggaacggccatcaagttggcccgt
tttgatccccgaggagccctgttggctgagctcgaggtggccaccccccagcccgcggtg
ccaggagccgtgacgatggccctctgcgatgccgtcgaggagttggatcctgatggagcc
gcggccttggtgggggtcggattgcctgggccgatggatgccacggctcgggttgcgcgg
gtttgcatcaacctgccgggttgggaggacgtgccgctggcggagtggttggaggtgcgg
ttgcagcgacgcgtcaccctcgccaacgacggcaattgcgctgtggtgggagaggcctgg
tggggcgctgccaaggggttcagcgatgtggtgctgttgaccctcggcaccggagttgga
ggcggtgttctgctcggtgggcagctgttcaccggccacaacggcgcggcggcggaaccg
ggcttgatcggtgtcgaccccgatggtcccgcttgcaacagcggaaaccgcggatccctg
gagcagttcgcgagcattgcagcgttgcgtcgcctgtgcgaccgggacccccgggagttg
agtctggctgcagaggagggggagccggcagcccttgaggtgtgggagcgctacggcact
cgccttggggtggggctgtcatccctggtgtacgtcttcacgccgcagctggtgttgttg
ggcggtggtctggccggggctgctcgccatttcctgcccgcggtgcgacgggaggtggag
ctgcgggtgcaggcggtgtcccgggagggactgcggatcgacgcttgtgctcttggcaat
ggagccggtcgcctgggggcggcgcggctggcgctgttgcgcctgggcgggatgatggcc
gacgactga

DBGET integrated database retrieval system