KEGG   Synechococcus sp. WH8102: SYNW1494Help
Entry
SYNW1494          CDS       T00144                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
syw  Synechococcus sp. WH8102
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1446826..1449153
Genome map
AA seq 775 aa AA seqDB search
MGGAAVLDWMVQDGERLANCRHDHPLAILGPQPSDAGWTVRVWMPEAHSVTLLEGGREAL
MTAPNHPWVFETTLSHDPGSNYKVRVERGGITHEQHDPWAFRDEWMGDMDRHLFAQGNHH
HIWQRMGAHLTQRDGISGVMFCLWAPHALSVSILGDLNSWDGRHHPMQQRLGGIWELFIP
GLAEGSLYKYEIRTQDGHCYQKADPYGFQHEVRPDNSSVVARLDGFQWSDGSWMQRRDSS
NPLEQPISVYEMHLGSWIHASAEEPWIQPDGSPRAPVPAADMKPGARLLTYAELAARLIP
YVKERGFTHIELMPITEHPFDGSWGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVII
DWVPGHFPKDAHGLAFFDGTHLYEHGDPRIGEHKEWGTLIFNYSRNEVRNFLVANLVFWF
EQFHIDGIRVDAVASMLYRDYLRPDGEWLANEHGGRENTEAVQFLQQANHVLFQHFPGAL
SIAEESTTWPMVTQPTEIGGLGFNLKWNMGWMHDMLDYFELDPWFRQFHQNNITFSIWYT
YTENFMLALSHDEVVHGKSHLLHKMPGDDWQKYANTRALLAYMWTHPGKKTIFMGMEFGQ
RAEWNVWGDLQWDLLNYEPHKGIQLLVDDLNTLYKAEPALWRDDFDQFGFQWIDCNDNRH
SVISFMRRESSSGTWLVVVANFTPQSHSHYRVGVPLAGFYEEIFNTDAARYGGSNLGNMG
GKPTDEWSIHGYENSLDLCLPPLSLLVFRHDPKRSLQAASASACDKADDETADTN
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcgcggcagtcctcgactggatggttcaggacggcgaacgtctcgcgaattgt
cggcacgatcacccgttagcgatcctcggcccgcaaccaagcgatgcgggctggactgtt
cgggtgtggatgccggaagcccacagcgtgacgctgctggagggcggtcgggaagcattg
atgaccgcacccaatcacccctgggtgtttgaaacaacgctcagccacgaccccggcagc
aactacaaggtgcgggtcgagcgcggcggcatcactcacgaacaacacgacccctgggcg
ttcagggacgaatggatgggcgacatggatcgccatttgtttgcccagggcaatcaccac
cacatctggcaacggatgggcgcccacctcacgcagcgtgatggcatctccggggtgatg
ttctgcctttgggcaccgcatgccctgagcgtgtcgatcctgggtgatctcaactcctgg
gatggtcgtcaccaccccatgcagcagcgcttgggtgggatctgggaattgtttattcca
gggcttgctgaaggttctctctacaagtacgaaatccgcacccaggacgggcactgttat
cagaaagccgacccctacggcttccaacacgaggttcgcccggacaacagttcagtggtg
gctcgcctggatggcttccaatggtcggacggctcctggatgcagcgacgcgatagcagc
aatccgctggagcagcccatctccgtgtatgagatgcatctcggcagctggatccatgcc
agcgccgaagaaccctggattcagcccgacggcagcccgcgagctccggtgcccgctgcc
gacatgaaacccggcgctcggctgctcacctacgccgagttggcggctcgcctgatccct
tacgtcaaggaacggggattcacccacatcgaactgatgccgatcaccgagcatcccttt
gatggctcctggggttatcaagtcaccggctggtacgcccccaccagccgctacggcact
ccggatgaattccgggcctttgtggatcgctgccacgccgaaggcatcggcgtcatcatc
gactgggtgcctggccacttccccaaggatgcccatggcctggccttctttgacggcaca
cacctctacgaacacggagatccgcgcatcggtgagcacaaagagtggggaacgctgatc
ttcaactacagccgcaacgaggttcgtaacttcctggttgccaatctggtgttctggttc
gaacagttccacatcgacggcattcgcgttgatgcggtggcctcaatgctgtatcgcgac
tatctgcgtccagatggcgaatggctggctaacgagcatggcggtagagagaacacggaa
gccgttcaattcctgcagcaggccaaccatgtgctcttccagcacttccccggggcgttg
tcgatcgcggaagaatccacaacctggccgatggtgacccaacccacagaaatcggtggc
ctgggcttcaacctgaaatggaacatgggttggatgcacgacatgctcgattacttcgag
ctggatccctggttccgtcagttccaccagaacaacatcaccttctcgatctggtacacc
tacaccgaaaacttcatgctggcgctcagccacgacgaagtggtgcatgggaaaagccat
cttctccacaagatgccaggtgacgactggcagaaatacgccaacacccgagcactgctc
gcctacatgtggacccatcccggcaagaaaaccatcttcatggggatggaattcggccag
cgcgctgaatggaatgtctggggagatctgcaatgggatctgctgaattacgaaccccac
aaaggcatccagctgctggtggatgacctcaacacgctgtacaaagctgagccggccctc
tggcgcgacgacttcgaccagttcggattccagtggattgattgcaatgacaaccgtcat
tccgtgatcagtttcatgcggcgtgaaagcagcagtggcacctggcttgtggtggtggcc
aacttcacaccacagagccattcccattaccgggtgggtgttccgctggcgggcttctac
gaggagatcttcaacaccgatgcagcccgttacggcggcagcaaccttggcaacatgggc
ggcaagccaacggatgaatggagcatccacggctacgagaactccctggatctctgccta
cctcccctcagtctcctggtgttccgccacgaccccaagcgcagcctccaagcggcttca
gcatcagcctgtgacaaagcagatgacgaaactgctgacaccaactag

DBGET integrated database retrieval system