KEGG   Synechococcus sp. WH8102: SYNW1519Help
Entry
SYNW1519          CDS       T00144                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNW1519 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNW1519 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNW1519 (trpA)
Enzymes [BR:syw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYNW1519 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1463649..1464458)
Genome map
AA seq 269 aa AA seqDB search
MSSQMLSPIAQRFEQLKHEKRLALMPFLMAGDPDLATTSEVLLSLQNSGADMVELGMPYS
DPLADGPVIQAAAARALAAGTTPGKVLEMLTSLKGQLTIPVILFTYSNPLLNVGMEAFCE
RAAAAGAAGLVVPDLPLEEAERLSPLAEQQGLDLVLLVAPTTPADRMVRIGQRSRGFTYL
VSVTGVTGERAQMETRVEGLVEELKQSSAVPVAVGFGISGADQVRQVRSWGADGAIVGSA
LVKRMAAAGEGQIAEEAGQFCRELRNAAD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccagatgttgtcacccatcgctcagcgctttgagcagctcaaacatgagaag
cgtctggccttgatgccatttctgatggctggcgaccctgatttggcaacaacctcagag
gtgttgctgagtttgcagaactcaggggcggacatggtggaactggggatgccctacagc
gacccactggcggatggtcctgtgatccaggccgcggcagcacgagcgcttgctgcgggc
acaacaccaggaaaggtgttggagatgctgacctctttgaagggccaactcaccattccg
gtgattctgttcacttactccaaccccttgctgaatgtgggcatggaggcgttctgtgaa
cgcgctgcagcggcgggtgccgctgggcttgtggttcccgatctgcccttggaagaagcc
gaacggctgtcgcctctggcggaacaacaggggctggatctggttctcctggttgcacca
acaacccccgctgatcggatggtgcgaattggtcaacgcagccggggtttcacttatctg
gtgagcgtgaccggtgtcaccggggaacgtgcccagatggaaaccagggtggaggggctt
gttgaggagctgaagcaatcctcggcagttccagtggctgtgggtttcggtatctctgga
gctgatcaggtgcgccaggtgcgcagctggggggcagacggcgccatcgtcggcagcgcg
ctggtcaagcggatggcggcggccggtgaaggccaaattgctgaggaagccgggcaattc
tgcagagagctccgcaacgcagctgactaa

DBGET integrated database retrieval system