KEGG   Synechococcus sp. WH8102: SYNW1551Help
Entry
SYNW1551          CDS       T00144                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
syw  Synechococcus sp. WH8102
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SYNW1551
Enzymes [BR:syw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SYNW1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1492086..1492919)
Genome map
AA seq 277 aa AA seqDB search
MPLSSTSALPPLRLAVVGHVEWVEFLAVDQLPIPGGIGHALRTLQEPAGGGAVAAVQMAR
LQRQPVQFFTALGRDSVGEACVKRLEDLGLEVHVAWREAPTRRGVSLVDGEGDRAITVIG
ERLTPSLDDNLPWETLGEFDGLFVTAADEPLFKACRSAAVLAATPRVRLPVLQEARVSLD
ALIGSGLDPGERVEPEQLNPAPHTLIRTEGAAGGLSLPGGRYDPAPLPGRLVESYGCGDC
FAAGVVTGLAARWSLANAIDLGAQCGAACATRFGPYE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ctgccgttgtcttccacttcagccctgccgcccctgcgcttggccgtcgtcgggcatgtt
gagtgggttgaatttctggcggtggatcagttgcccattcccgggggcattggacacgcc
ctgcggaccctgcaggaaccagccggtggtggtgccgttgctgctgtgcagatggcacgg
ttgcagcggcaacccgtccagttctttacggccttaggccgcgattcggtcggggaagcc
tgcgtcaagcggctcgaagatctgggccttgaggttcatgtcgcctggagggaagcgcca
actcggcggggcgtgagcttggtcgatggtgagggggatcgggcgatcaccgtgataggc
gagcggctgaccccatcactggacgacaaccttccctgggagaccctcggcgagttcgac
ggcctctttgtcacggcagcggatgaacctctgtttaaagcctgccgctctgctgcagtc
ctggcggcgactccgcgggttcgtttgcctgtgcttcaggaagccagagtttccctcgac
gcccttattggtagtggccttgatccaggtgagcgggtagagccagagcagttaaaccct
gctccacacacactgattcgcacggaaggtgccgctggaggactcagtcttccgggcggt
cgttatgacccagcacccctacccgggcgattggtcgaaagctatggatgtggtgactgc
tttgccgcgggagtggtcacaggtcttgctgcgcgatggtccttggcgaacgccatcgac
ttaggtgcccaatgtggtgccgcctgtgcgacgcgatttggaccctacgaatag

DBGET integrated database retrieval system