KEGG   Synechococcus sp. WH8102: SYNW1593Help
Entry
SYNW1593          CDS       T00144                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
syw  Synechococcus sp. WH8102
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SYNW1593
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SYNW1593
Enzymes [BR:syw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SYNW1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1535336..1537837)
Genome map
AA seq 833 aa AA seqDB search
MAPFGLSALRSLLGRGVGNTPWQPPESSWSRRFGLGWESPYTVRYASNLDDGPDHGMPLG
GFGAGCLGRSPSGAFNLWNLDGGEHWFGSIPDCQFALWEQQGEDVRAHALATAPDRDDTD
PSGGTPLSAWQWYPASTQGRSTGTYAARYPLSWTHHEDVYRAGVLCEAFSPILPGDYQRT
SYPVAVFRWQFSNPTDQPLELSLMLCWRNTVGWFTNTDAAAEVHFRDDGSPEHNYAPAIG
RGEGQRNRQVDQPGFSGVLLEGQPSMPLAEGEGQWCLALPDDLDGVHVMRCSRWDPSGDG
SELWTPFAADGRIPDSNNDRASRSGEQASAAIAVKFTLAPGASREIPLVISWDLPVTAFA
SGSSALRRYTDFFGSSGSNAAAIAAEALRDWRQWREQIDAWQQPVLARMQLPEPLRMALF
NELYDLCSGGSLWTAASPADPHGRFGVLECLDYAWYESLDVRLYGSLALLQLWPELDKAV
LRSFARAIPAADGSQRPIGWYFTQGRGRVEADRKVAGATPHDLGAPNERPFDATNYTAYQ
DCNLWKDLASDYMLQVWRTFRLAPTGEDLRFLAECWPSAVQALDYLKGFDVNNDGLPDNG
GAPDQTFDDWPLQGVSAYCGALWIAALEAALAMAQRLQLDLGLDTAAEQRRFGAWLEQSR
ANFDDLLWNGEYYRIDAESGTPVVMADQLCGDFYARLLGLPPVVSDARARSTLQAVKEAC
FERFESGRLGVANGLRRDGSPLDPNGTHPLEVWTGINFGLASYYRLMGESKTALAICSAV
VGQVYSGGLQFRTPEAITAVNTFRACHYLRAMAIWGLWATDTGWERIPGVAER
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggcccccttcggactttccgctctgcgttcgctgctggggcgtggcgtcggcaacaca
ccatggcaacctccggagtccagctggagtcgtcgcttcggcctgggctgggagtcgcct
tacaccgttcggtacgccagcaacctcgacgatggccccgaccacggcatgcccctcggc
ggcttcggggctggctgcctcggccgttcccccagcggagccttcaacctctggaacctc
gatggtggtgagcactggttcggatcgatccccgactgtcagttcgccctctgggagcag
cagggcgaggacgtccgtgcccatgccctggccacggctcccgaccgtgatgacaccgac
cccagtggcggcacacccctgagcgcctggcagtggtaccccgccagcacccagggccgc
agcaccggcacctacgccgcccgctatcccctcagctggacccaccacgaggacgtttac
cgcgccggcgtcctctgcgaggccttcagtcccatccttcctggggattaccagcgcacc
agctatccggtggcggtgttccgctggcaattcagcaaccccaccgatcagccgctggag
ttgtccctgatgctgtgctggcgcaacacggtgggttggttcacaaacaccgacgctgcc
gcggaggtgcatttccgtgatgacggcagcccggagcacaactacgccccggcgatcggt
cgtggtgaaggacagcgcaaccgccaggttgatcagccgggatttagcggagtgctgctg
gagggccagccctcgatgccactggcggaaggcgagggtcagtggtgcctggctctgccg
gatgacttggacggcgtgcatgtgatgcgctgcagccgctgggatcccagcggtgatggc
agtgagttgtggacccccttcgccgccgatgggcggatccctgacagcaacaacgaccgc
gccagccgttccggcgagcaggccagtgctgccatcgctgtgaaattcacgctggctccc
ggtgccagccgtgagattccgctggtgatcagctgggacctgccggtgacggctttcgcc
agtggcagcagcgcgctgaggcgttacaccgacttcttcggcagcagcggcagcaatgcc
gccgccattgctgcagaagccctgcgcgattggcgccagtggcgggagcagatcgatgcc
tggcagcagccggtgttggcccgtatgcaattgccggagccgctgcggatggcgttgttc
aacgagctctacgacctctgcagtggcggcagcctttggactgcggcgtcaccggcggat
ccccacggccgcttcggtgttctggagtgcctcgactacgcctggtacgaaagtcttgac
gtgcgcctgtacggctcactggcgctgttgcagctctggccggagctggacaaagcggtg
ctgcgcagttttgcccgtgccattcctgccgcggatggcagccaacggccgatcggttgg
tatttcacccagggccgtggccgggtggaggcggaccgcaaggtggcgggagcgacgccc
catgacctgggggcccccaacgaacgccccttcgacgccaccaattacaccgcttatcag
gactgcaacctctggaaggatctggccagtgattacatgctgcaggtgtggcgcaccttc
cgccttgcgcccaccggcgaagacctgcgctttctggcggagtgctggccctctgcggtt
caggccctcgattacctcaaaggctttgacgtcaacaacgatggtctccccgacaacggc
ggtgcccctgatcaaacctttgacgactggccgttgcagggtgtgagtgcctactgcggc
gcactctggatcgcggccctggaggccgcgctggcgatggctcagcggctgcagcttgat
ctcggcctggacactgccgcggaacagcggcggttcggtgcctggctcgagcaatcccgc
gccaacttcgacgacctgctctggaacggcgagtactaccggatcgatgccgagagcggc
acaccggtggtgatggcggatcaactctgcggtgacttttacgcacggctgctggggctg
ccaccggtggtcagtgacgccagggcacgcagcaccctgcaggcggtgaaggaggcctgt
tttgaacggtttgagtccggacgtctcggcgtggccaacggtttgcggcgggatggcagt
cccctggaccccaacggcacgcaccctctggaggtgtggaccggcatcaatttcggtttg
gccagttactaccggctgatgggagagagcaaaacggcgttggccatctgctcagccgtg
gtgggccaggtgtattcaggtggtctgcagttccgcaccccggaagcgatcactgccgtg
aacaccttccgtgcctgccactacctgcgggccatggccatctggggcctgtgggccacg
gacaccgggtgggagcggattcccggcgtggcggaacgctga

DBGET integrated database retrieval system