KEGG   Synechococcus sp. WH8102: SYNW1734Help
Entry
SYNW1734          CDS       T00144                                 

Gene name
folE
Definition
(GenBank) putative GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00790  Folate biosynthesis
syw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNW1734 (folE)
Enzymes [BR:syw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SYNW1734 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: CAE08249
JGI: SYNW1734
CyanoBase: SYNW1734
CYORF: SYNW1734
UniProt: Q7U5H3
Position
complement(1665291..1666052)
Genome map
AA seq 253 aa AA seqDB search
MTTTVPFVTNGASNGISNGNGQPRLSAEVSSRIRERLQAAGVSFLANDNIAEHIEPGELR
ALEVEVADKVRDLLRTLVIDIDNDHNTHETAERVARMYLHEVFKGRYHHQPKVASFPNVK
KLDEIYTVGPITVRSACSHHLVPIMGNCWIGIKPGVRVIGLSKFTRVADWVFSRPHIQEE
AVMILADEIEKLCEPQGLGIIIKAQHYCMKWRGVKEPQTSMVNSVVRGDFRHDPSLKQEF
FELVRQQEALLST
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccgtccctttcgtgaccaacggcgccagcaatggcatctccaacggcaac
ggccagcctcgtcttagtgccgaggtgtcgagccggatccgcgagcggcttcaggccgca
ggggtgtcgttcctcgccaacgacaatattgctgagcacatcgaacccggtgaactgaga
gcgctggaggttgaggttgcggacaaagtccgcgacctgttgcgcacgttggtgatcgat
atcgacaacgatcacaacacccatgaaaccgccgagcgtgtggctcggatgtatctccat
gaggtgttcaaaggccgctaccaccaccaaccgaaggtggccagtttccccaacgtcaag
aagctggatgagatctacaccgttggcccgatcacggtgcgttcggcctgttctcatcac
ctggtgcccatcatgggcaattgctggatcggcatcaaacccggtgtccgggtgatcgga
ctgtccaagttcacgcgcgtggcggactgggtcttctcacgcccccacatccaggaagag
gcggtgatgatcctggccgatgagatcgaaaagctctgtgagccccagggtctcggcatc
atcatcaaggcccagcactactgcatgaagtggcgcggtgtgaaagagccgcaaaccagc
atggtgaattccgtggtgcggggcgatttccgccacgacccgagcctgaagcaggaattc
ttcgaactggtgcgtcagcaggaggcgctgctcagcacctga

DBGET integrated database retrieval system