KEGG   Synechococcus sp. WH8102: SYNW1734Help
Entry
SYNW1734          CDS       T00144                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
syw  Synechococcus sp. WH8102
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNW1734 (folE)
Enzymes [BR:syw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SYNW1734 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1665291..1666052)
Genome map
AA seq 253 aa AA seqDB search
MTTTVPFVTNGASNGISNGNGQPRLSAEVSSRIRERLQAAGVSFLANDNIAEHIEPGELR
ALEVEVADKVRDLLRTLVIDIDNDHNTHETAERVARMYLHEVFKGRYHHQPKVASFPNVK
KLDEIYTVGPITVRSACSHHLVPIMGNCWIGIKPGVRVIGLSKFTRVADWVFSRPHIQEE
AVMILADEIEKLCEPQGLGIIIKAQHYCMKWRGVKEPQTSMVNSVVRGDFRHDPSLKQEF
FELVRQQEALLST
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccgtccctttcgtgaccaacggcgccagcaatggcatctccaacggcaac
ggccagcctcgtcttagtgccgaggtgtcgagccggatccgcgagcggcttcaggccgca
ggggtgtcgttcctcgccaacgacaatattgctgagcacatcgaacccggtgaactgaga
gcgctggaggttgaggttgcggacaaagtccgcgacctgttgcgcacgttggtgatcgat
atcgacaacgatcacaacacccatgaaaccgccgagcgtgtggctcggatgtatctccat
gaggtgttcaaaggccgctaccaccaccaaccgaaggtggccagtttccccaacgtcaag
aagctggatgagatctacaccgttggcccgatcacggtgcgttcggcctgttctcatcac
ctggtgcccatcatgggcaattgctggatcggcatcaaacccggtgtccgggtgatcgga
ctgtccaagttcacgcgcgtggcggactgggtcttctcacgcccccacatccaggaagag
gcggtgatgatcctggccgatgagatcgaaaagctctgtgagccccagggtctcggcatc
atcatcaaggcccagcactactgcatgaagtggcgcggtgtgaaagagccgcaaaccagc
atggtgaattccgtggtgcggggcgatttccgccacgacccgagcctgaagcaggaattc
ttcgaactggtgcgtcagcaggaggcgctgctcagcacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system