KEGG   Synechococcus sp. WH8102: SYNW1734Help
Entry
SYNW1734          CDS       T00144                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
syw  Synechococcus sp. WH8102
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1665291..1666052)
Genome map
AA seq 253 aa AA seqDB search
MTTTVPFVTNGASNGISNGNGQPRLSAEVSSRIRERLQAAGVSFLANDNIAEHIEPGELR
ALEVEVADKVRDLLRTLVIDIDNDHNTHETAERVARMYLHEVFKGRYHHQPKVASFPNVK
KLDEIYTVGPITVRSACSHHLVPIMGNCWIGIKPGVRVIGLSKFTRVADWVFSRPHIQEE
AVMILADEIEKLCEPQGLGIIIKAQHYCMKWRGVKEPQTSMVNSVVRGDFRHDPSLKQEF
FELVRQQEALLST
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccgtccctttcgtgaccaacggcgccagcaatggcatctccaacggcaac
ggccagcctcgtcttagtgccgaggtgtcgagccggatccgcgagcggcttcaggccgca
ggggtgtcgttcctcgccaacgacaatattgctgagcacatcgaacccggtgaactgaga
gcgctggaggttgaggttgcggacaaagtccgcgacctgttgcgcacgttggtgatcgat
atcgacaacgatcacaacacccatgaaaccgccgagcgtgtggctcggatgtatctccat
gaggtgttcaaaggccgctaccaccaccaaccgaaggtggccagtttccccaacgtcaag
aagctggatgagatctacaccgttggcccgatcacggtgcgttcggcctgttctcatcac
ctggtgcccatcatgggcaattgctggatcggcatcaaacccggtgtccgggtgatcgga
ctgtccaagttcacgcgcgtggcggactgggtcttctcacgcccccacatccaggaagag
gcggtgatgatcctggccgatgagatcgaaaagctctgtgagccccagggtctcggcatc
atcatcaaggcccagcactactgcatgaagtggcgcggtgtgaaagagccgcaaaccagc
atggtgaattccgtggtgcggggcgatttccgccacgacccgagcctgaagcaggaattc
ttcgaactggtgcgtcagcaggaggcgctgctcagcacctga

DBGET integrated database retrieval system