KEGG   Synechococcus sp. WH8102: SYNW1898Help
Entry
SYNW1898          CDS       T00144                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syw  Synechococcus sp. WH8102
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:syw00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1810677..1811594)
Genome map
AA seq 305 aa AA seqDB search
MMPSPAVLPAGVNQDVLLSELRRLSWGAADILRAYARGEQPPHGFPKALSVDDGGEGPVS
AADLAVNQWLLDGLSAAFPKADWTLLSEETAKEQLTEGQPLQAEWLWILDPLDGTKDFLQ
GTGEYAVHLALVRGQRPVLGVVLLPEADELWIGIVGEGAWCEDRQGERSPVRFSDRTAVS
DLILVASRSHRDDRLVKLIDALALGGSKAVGSVGYKVATILRGETDLYVSLSGRSAPKDW
DMAAPEAVLLAAGGRFTHADQTDLAYNTGDVRQAGCLIASHGKAHAELGERATRAMAEID
PGFQV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgccaagccctgccgtcctgcctgccggcgtcaaccaggacgttctgttgtcagaa
ctccgtcgcctcagctggggggctgccgacatcctcagggcctatgcccgcggcgagcaa
ccgccccatggcttccccaaggctctcagcgtcgacgatggcggtgaaggccctgtttct
gctgctgatctggccgtgaaccaatggctgctggatggcttgtcagctgcgtttcccaag
gctgactggaccctgctcagtgaagaaacggccaaggagcagctcacggaaggccaaccg
ctgcaggcggagtggctctggatcctggatcccttggacggcaccaaggatttcctccag
ggcactggcgaatacgccgttcatctggcactggtgcgggggcaacgtcccgtgctaggg
gtggtgctgctgccggaagccgacgaactctggatcggcatcgtcggcgagggcgcctgg
tgcgaggaccgtcagggtgagcgctcgcccgttcgcttcagcgatagaaccgctgtttcg
gatctgatcctggtggccagtcgcagccaccgcgacgaccgtctggtgaagctgattgac
gctctcgcgcttggaggttccaaggcggtgggcagcgttggctacaaggtcgccaccatc
ctgcggggcgaaactgatctctacgtctccctgtccggacgcagtgcccccaaggattgg
gacatggcggcccctgaggccgtgttgctggcggccggtggacgcttcacgcatgctgat
cagacggacctcgcttacaacactggcgatgtgcgtcaggccggttgcctgatcgccagc
catggaaaagcccacgccgagctcggagagcgtgcgacgcgggcgatggccgagatcgat
cccggctttcaggtttga

DBGET integrated database retrieval system