KEGG   Synechococcus sp. WH8102: SYNW1898Help
Entry
SYNW1898          CDS       T00144                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syw  Synechococcus sp. WH8102
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SYNW1898
Enzymes [BR:syw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SYNW1898
Transfer RNA biogenesis [BR:syw03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SYNW1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1810677..1811594)
Genome map
AA seq 305 aa AA seqDB search
MMPSPAVLPAGVNQDVLLSELRRLSWGAADILRAYARGEQPPHGFPKALSVDDGGEGPVS
AADLAVNQWLLDGLSAAFPKADWTLLSEETAKEQLTEGQPLQAEWLWILDPLDGTKDFLQ
GTGEYAVHLALVRGQRPVLGVVLLPEADELWIGIVGEGAWCEDRQGERSPVRFSDRTAVS
DLILVASRSHRDDRLVKLIDALALGGSKAVGSVGYKVATILRGETDLYVSLSGRSAPKDW
DMAAPEAVLLAAGGRFTHADQTDLAYNTGDVRQAGCLIASHGKAHAELGERATRAMAEID
PGFQV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgccaagccctgccgtcctgcctgccggcgtcaaccaggacgttctgttgtcagaa
ctccgtcgcctcagctggggggctgccgacatcctcagggcctatgcccgcggcgagcaa
ccgccccatggcttccccaaggctctcagcgtcgacgatggcggtgaaggccctgtttct
gctgctgatctggccgtgaaccaatggctgctggatggcttgtcagctgcgtttcccaag
gctgactggaccctgctcagtgaagaaacggccaaggagcagctcacggaaggccaaccg
ctgcaggcggagtggctctggatcctggatcccttggacggcaccaaggatttcctccag
ggcactggcgaatacgccgttcatctggcactggtgcgggggcaacgtcccgtgctaggg
gtggtgctgctgccggaagccgacgaactctggatcggcatcgtcggcgagggcgcctgg
tgcgaggaccgtcagggtgagcgctcgcccgttcgcttcagcgatagaaccgctgtttcg
gatctgatcctggtggccagtcgcagccaccgcgacgaccgtctggtgaagctgattgac
gctctcgcgcttggaggttccaaggcggtgggcagcgttggctacaaggtcgccaccatc
ctgcggggcgaaactgatctctacgtctccctgtccggacgcagtgcccccaaggattgg
gacatggcggcccctgaggccgtgttgctggcggccggtggacgcttcacgcatgctgat
cagacggacctcgcttacaacactggcgatgtgcgtcaggccggttgcctgatcgccagc
catggaaaagcccacgccgagctcggagagcgtgcgacgcgggcgatggccgagatcgat
cccggctttcaggtttga

DBGET integrated database retrieval system