KEGG   Synechococcus sp. WH8102: SYNW1933Help
Entry
SYNW1933          CDS       T00144                                 

Gene name
hemB
Definition
(GenBank) possible delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00860  Porphyrin and chlorophyll metabolism
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNW1933 (hemB)
Enzymes [BR:syw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SYNW1933 (hemB)
Exosome [BR:syw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SYNW1933 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CAE08448
JGI: SYNW1933
CyanoBase: SYNW1933
CYORF: SYNW1933
UniProt: Q7U4Y0
Position
complement(1837481..1838482)
Genome map
AA seq 333 aa AA seqDB search
MELTYRPRRLRRTPALRAMVREHQLSSADFIYPLFVHEGTDVEPIGAMPGASRWSLAALT
GEVQRAWNLGVRCIVLFPKVAEGLKTEDGAECFNANGLIPRAIRQIKQEVPGMAIMTDVA
LDPYSCDGHDGIVSPAGVVLNDETIELLCKQAVVQAEAGADLIGPSDMMDGRVGAIREAL
DDEGFEHVGIISYTAKYSSAYYGPFREALDSAPRAAGSKPIPTNKDTYQMDPANAREAIT
EAQLDEQEGADIMMVKPGLAYLDIIHRLRNESELPIAAYNVSGEYSMVKAAAERGWIDER
AVVLETLLSFKRAGADLILTYHACDAAEWLRQG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggagctcacctaccgcccccgtcgtttacgccgcacaccggccctgcgcgccatggtg
cgggagcaccagttgtcctcagcggatttcatctatccactgtttgtccatgaggggacc
gacgtcgaacccatcggtgccatgccaggtgcgagtcggtggagtctggcggccctgacc
ggagaagttcagcgcgcctggaacctgggggtccgctgcatcgttctgttccccaaggtt
gccgaggggctgaaaactgaagacggcgctgagtgcttcaacgccaatggcctgattccc
agagcaattcgtcagatcaagcaggaggtgcctgggatggcgatcatgactgacgtggca
ctcgatccctattcctgcgacggccacgatggcatcgtcagcccagcgggggtcgtcctc
aacgacgagacgatcgaattgctctgtaaacaggctgtggttcaagccgaagccggtgcc
gatctgatcggccccagcgacatgatggacggacgagtcggggccattcgtgaggccttg
gacgacgaaggctttgagcacgtcggaatcatcagctacaccgcgaagtactcctctgcc
tattacgggccattccgtgaggccctggattcagccccccgtgctgccggcagcaagccg
attccaaccaacaaggacacatatcagatggaccccgccaatgcccgggaagccatcacg
gaagcccagctggatgagcaggaaggcgccgacatcatgatggtgaagccgggtttggcc
tacctggacatcattcaccgactgcgcaatgagtcggagctgcccattgctgcttacaac
gtcagtggtgagtattcgatggtgaaggccgccgccgaacgcggttggatcgacgagcgt
gctgtggttctcgaaaccctgctcagcttcaagcgggccggtgcggatctgatcctcacg
tatcacgcctgtgatgccgcggaatggctgcgtcagggctga

DBGET integrated database retrieval system