KEGG   Synechococcus sp. WH8102: SYNW1953Help
Entry
SYNW1953          CDS       T00144                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SYNW1953
Enzymes [BR:syw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SYNW1953
Exosome [BR:syw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SYNW1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1857280..1858785
Genome map
AA seq 501 aa AA seqDB search
MADQPLLLALDQGTSSSRAAVFDAKGDLVASATAPLPIQYPADGWVEQHPGDIWNSQRQA
LQDLHQQLDEEQRRAVVSCGITNQRETTVLWRRSSGSPCGPALVWQDGRTADICQAWKAD
GLESAWCQRTGLLLDPYFSASKIRWMLEHHPEAAAAAAQGDLCFGTVESWLLWNLTGGQR
HGSDMSNASRTLLMDLEQRCWMDEFREQTGLPANALPELLPCRGEFGHIAAKLPFAGLPI
QALLGDQQAATLGQLCLQPGEAKCTYGTGAFLVINTGDSIRRSSDGLLSTLGWTDASGTP
TYCLEGSLFNAGTVVQWLRDGLQIIEQADEVNALAQSVPDSGGVMLVPAFTGWGTPHWDP
QARGVLVGLTRDSNRGHIARAALEGIALSVATLVELAGEALGRGLGELAVDGGAAASDPL
LQAQADSTGLTVRRPRNLESTARGIALFAGVQCGLIPDLSAIAAHRQDDVQRFEPQINTE
RRRLQRDRWNDAVNRSLGWHG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcagcctctcctgttggcgctggatcaaggcaccagcagttcccgagcagcg
gtgtttgacgccaagggcgaccttgtggccagtgcgacggcgcccctaccaatccaatac
cccgccgatggctgggtggaacaacaccccggcgacatctggaacagccaaaggcaggca
ctgcaggatctgcaccaacagctcgatgaggagcaacgtcgggccgtggtgagctgcggc
atcaccaatcaacgcgaaaccacggtgctctggcgtcgcagcagcggcagcccctgcgga
ccggccctggtctggcaggacggccgtacagcagacatctgccaagcctggaaagcagac
ggcctcgaatccgcgtggtgccagcgcaccggcttgctgctggatccgtacttcagcgcc
agcaagatccgttggatgctcgagcatcaccccgaggcggcagccgctgcggcccagggc
gatctgtgcttcggcacggtggagtcgtggctgctctggaacctcacgggaggacagcgc
cacggcagtgacatgagcaatgccagccgcacgctgctgatggatctcgagcagcgctgt
tggatggatgaattccgcgaacagacgggtcttcctgcgaacgctctaccggagctgttg
ccctgtcgtggggagttcggccacatcgcagcgaagcttcccttcgccggattgcccatc
caggccctcctcggtgatcaacaggccgcgacccttggtcagctctgtctgcagcctggc
gaagccaaatgcacctatggcactggggcctttctggtgatcaataccggcgacagcatc
cgccgctccagcgacggtctactcagcacccttggctggaccgatgccagcggcacaccc
acctactgcctggagggcagcctgttcaatgcaggaactgtggtgcagtggctgagggac
ggcttgcagatcatcgagcaggctgatgaggtgaatgccctggcgcaatcggtgccggac
agcggcggggtgatgctggtgcccgccttcaccggttgggggaccccccactgggacccc
caggcccgcggtgtgctggtggggctcacgcgggacagcaaccgcggccacatcgcccga
gccgccctggagggcatcgccctgtcggtggccaccctggtggagctggcgggagaggcc
ctcgggcgtggcctgggggaactggcggtggatgggggggctgccgcctccgatcccttg
ttgcaggcgcaggcggacagcaccggcctgacggtgcgccgcccccggaacctggaaagc
acagcccgcggcatcgctctgtttgccggtgtgcaatgcggcctgatccccgacctgtcc
gccatcgccgcccaccggcaggacgatgtacagcgcttcgaaccgcagatcaacaccgag
cggcgcaggcttcaacgtgaccgctggaatgacgccgtgaaccgcagcctgggctggcat
ggctga

DBGET integrated database retrieval system