KEGG   Synechococcus sp. WH8102: SYNW1961Help
Entry
SYNW1961          CDS       T00144                                 

Gene name
FPG
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
syw  Synechococcus sp. WH8102
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:syw03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1867376..1868212
Genome map
AA seq 278 aa AA seqDB search
MPELPEVETVRRGLADRLSLFEIERVEVCRSRAIASSGGVAAFLVGLTGARVGTWSRRGK
YLMAALEPNRGIWGVHLRMTGQFQWIEEPSTPCTHTRVRFWNANGHELRFVDVRSFGEMW
WVPPDVELTVGIPGLARLGPEPFSEAFSAPYLKRQLKNSSRPIKTALLDQALVAGVGNIY
ADESLFSAGIPPLTPAGRLTLAQLERLRSSLVEVLTTSIGAGGTTFSDFRDLEGVNGNYG
GQAWVYRRGGEPCRRCGTIIRRDKLSGRSTHWCPTCQG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgccggaactccctgaggtcgagacggttcgccgaggtctggcggaccgtctctctttg
tttgaaattgaacgcgtcgaggtctgccgctcgcgagcgattgccagcagtggcggtgtc
gctgcctttctggtgggactgactggtgcaagggtcggaacctggagccggcgcggaaag
tacttgatggcagcgcttgaacccaaccgcgggatttggggggttcatctgcgcatgact
gggcagtttcagtggatcgaggagcccagcactccctgcacgcacacccgcgtgcgcttc
tggaacgccaacggccacgaactgcgcttcgttgatgtgcggagtttcggcgagatgtgg
tgggtccctcccgacgtggagctcactgttggaatcccggggttggcgcggctgggaccg
gaaccgttcagcgaggccttcagcgctccatacctcaagcggcaactgaagaacagcagc
cgcccgatcaaaacagcacttctggatcaggccctcgtggcaggtgtgggcaacatttat
gccgatgaaagcctgttctcggcgggcatccccccgctgacccccgctggacggctcacg
cttgcccagcttgagaggttgcgctcatccctggtggaggtgctcaccaccagcattggt
gccggcggcaccaccttcagtgacttccgtgatctggagggcgtcaacggcaattacgga
ggccaggcctgggtgtatcgccgagggggagaaccgtgtcggcgctgcggcacgatcatc
cgacgggacaagctgtcgggacgcagcacccattggtgcccgacctgtcagggctga

DBGET integrated database retrieval system